KEGG   Hydrogenophaga sp. PBC: Q5W_21135Help
Entry
Q5W_21135         CDS       T04491                                 

Definition
(GenBank) RNA methyltransferase
  KO
K07444  putative N6-adenine-specific DNA methylase [EC:2.1.1.-]
Organism
hyb  Hydrogenophaga sp. PBC
Brite
KEGG Orthology (KO) [BR:hyb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Q5W_21135
Enzymes [BR:hyb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     Q5W_21135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0020 THUMP MTS
Motif
Other DBs
NCBI-ProteinID: AOS81270
UniProt: A0A1C9VKI7
LinkDB All DBs
Position
complement(4451692..4452972)
Genome map
AA seq 426 aa AA seqDB search
MNQLQIFLPCAAGVEDFLAAEVQRITGVDSLQRSRGGVSLEASWRDALLLNLHSRLAQRV
LVRLWHGTYRAEQDLYTAAAEVAWEIWFTPKQTIKVELTAQHSPLKSLNFAALRIKDAVC
DRFRDKRGERPSVDTQRPDVRLFGHVTAETLTLYIDTTGEPLFKRGWREDKGDAPLKETL
AAAMIVATGWDALAREAATLADVPPLVDPCCGSGTVPIEAAQIALRIAPGGQRRFGFEKL
LPFQPHVWQALRDEARAAERPWPEGQAPIVFGSDVAFRMVDFAKRNAERARVAQAIELRG
GDALQRLPPSPRAGVLLLNPPYGERIAAAGVAGRNAAERARVGGREQARDEDGQTADAFF
ERLAAHWKSHYAGWSAWLLTPDLKLPGRMRFKESRRVPLWNGPIECRLFRFDLTARAPRP
ANPDKA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
ttgaaccagctccagatctttcttccctgcgccgccggcgtggaggactttctcgccgcc
gaggtgcagcgcatcaccggcgtcgattcgctgcagcgctcgcgcggcggtgtgtcgctg
gaggcctcgtggcgcgacgccttgctgctcaacctgcacagccgccttgcgcagcgcgtg
ctggtgcgcctgtggcacggcacctaccgcgccgagcaggacctgtacaccgccgccgcc
gaggtggcctgggaaatctggttcacgccgaagcagaccatcaaggtggagctgaccgcg
cagcacagcccgctcaagagcctgaacttcgccgcgctgcgcatcaaggacgccgtctgc
gaccgcttccgcgacaagcgcggcgagcgtcccagcgtggacacgcagcggcccgacgtg
cgcctgttcggccacgtcacggcagagacgctcacgctctacatcgacaccacgggcgag
ccgctgttcaagcgcggctggcgtgaggacaagggcgatgcgccactgaaggaaaccctg
gccgccgccatgatcgtggccaccggctgggacgcactggcgcgcgaggccgccacgctg
gccgacgtgccgccgctggtcgatccctgctgcggcagcggcaccgtgcccatcgaggcc
gcgcagatcgcgctcaggatcgcgccgggcggacagcgccgcttcggtttcgagaagctg
ctgccctttcagccccacgtgtggcaggccctgcgcgacgaggcgcgcgcggccgagcgg
ccctggcccgaaggccaggcgcccatcgtcttcggcagcgatgtggccttccgcatggtc
gacttcgccaagcgcaacgccgagcgcgcgcgcgtggcccaggccatcgaactgcgcggc
ggcgacgcgctgcagcgcctgccgcccagcccgcgcgcgggcgtgctgctgctcaacccg
ccatatggtgagcgcatcgcggcagcgggcgtggccggccgcaacgcagccgagcgcgcg
cgcgtgggcgggcgcgagcaggcccgcgacgaagacgggcagaccgccgacgccttcttc
gagcgtctggccgcgcactggaaatcgcactacgcgggctggagcgcctggctgctcacg
cccgacctgaagctgcccgggcgcatgcgcttcaaggagtcgcgccgcgtgccgctgtgg
aacggccccatcgagtgccggctgttccgcttcgacctgaccgcgcgcgccccgcgcccg
gcgaatcccgataaggcctga

DBGET integrated database retrieval system