KEGG   Hydrogenophaga sp. PAMC20947: E5678_03740Help
Entry
E5678_03740       CDS       T05960                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxyacyl-ACP dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
hyc  Hydrogenophaga sp. PAMC20947
Pathway
hyc00061  Fatty acid biosynthesis
hyc00780  Biotin metabolism
hyc01100  Metabolic pathways
hyc01212  Fatty acid metabolism
Module
hyc_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:hyc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    E5678_03740 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    E5678_03740 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hyc01004]
    E5678_03740 (fabZ)
Enzymes [BR:hyc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     E5678_03740 (fabZ)
Lipid biosynthesis proteins [BR:hyc01004]
 Fatty acid synthase
  Component type
   E5678_03740 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT
Motif
Other DBs
NCBI-ProteinID: QCB45217
UniProt: A0A4P7R5F9
LinkDB All DBs
Position
812320..812760
Genome map
AA seq 146 aa AA seqDB search
MIDIHQILKLLPHRYPILLVDRVLEIEHGKRIKAIKNVSINEPYFMGHFPHRPVMPGVLM
LEAMAQAAAILSFDAMGKTLDDNSVYYFAGIDAARFKRPVEPGDQLLMDVTLERSKAGIF
KFKGTCYVGEAVACQADLMCTMRTIA
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatatccaccagattctcaagctcctgccccaccgttatccgattcttttggtg
gatcgcgtgttggagatcgagcatggcaagcgcatcaaggccatcaagaatgtctcgatc
aacgagccgtacttcatggggcattttccgcaccgccccgtgatgcctggcgtgttgatg
ctggaagccatggctcaggccgcggccatcttgtcatttgacgccatgggcaagaccttg
gatgacaacagcgtgtattacttcgctggcatcgatgctgcacgcttcaagcgcccggtt
gagcccggtgatcagctgctcatggatgtcacgctggagcgctccaaagctggtattttc
aagttcaaaggcacctgctatgttggcgaagccgtggcttgccaggcagacctgatgtgc
actatgcgcaccatcgcctga

DBGET integrated database retrieval system