KEGG   Hydrogenophaga sp. PAMC20947: E5678_03895Help
Entry
E5678_03895       CDS       T05960                                 

Gene name
odhB
Definition
(GenBank) 2-oxoglutarate dehydrogenase complex dihydrolipoyllysine-residue succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hyc  Hydrogenophaga sp. PAMC20947
Pathway
hyc00020  Citrate cycle (TCA cycle)
hyc00310  Lysine degradation
hyc00380  Tryptophan metabolism
hyc01100  Metabolic pathways
hyc01110  Biosynthesis of secondary metabolites
hyc01120  Microbial metabolism in diverse environments
hyc01130  Biosynthesis of antibiotics
hyc01200  Carbon metabolism
Module
hyc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hyc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hyc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    E5678_03895 (odhB)
  09105 Amino acid metabolism
   00310 Lysine degradation
    E5678_03895 (odhB)
   00380 Tryptophan metabolism
    E5678_03895 (odhB)
Enzymes [BR:hyc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     E5678_03895 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: QCB45244
UniProt: A0A4P7R735
LinkDB All DBs
Position
853619..854884
Genome map
AA seq 421 aa AA seqDB search
MAIVEVKVPQLSESVAEATLLQWKKKAGEAVAIDEILIEIETDKVVLEVPAPSAGVLIEI
VQVDGATVTAEQLIARIDTSAAAGAAAPEAAPAPAAAPAPAAAPAAAAAAGGSKAGVAMP
AAAKLMADNKLAAGSVAGSGKDGRVTKGDVLAAVAGGGAKAVSAPVAIPTGAPTKVLPQV
AMVAPDLGDRPEERVPMTRLRARVAERLLQSQATNAILTTFNEINMAPVMEMRKRMQERF
EKEHGVKLGFMSFFVKAAVHALKKFPVINASIDGTDIVYHGYFDIGIAVGSPRGLVVPIL
RNADQMSFADIEKKIADFGQRAKDGKITLDDMTGGTFSISNGGTFGSMMSTPIINPPQSA
ILGVHATKERAMVENGQVVVRPMNYFAMSYDHRIIDGREAVLGLVAMKEALEDPARLLFD
I
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgtagaagtcaaagtcccacagctctctgagtcggtggccgaagccacgctg
ctgcagtggaaaaagaaggccggtgaggccgttgcgatcgatgaaatcctgatcgaaatc
gaaaccgacaaggtggtgctggaagtgcctgcgccttcggccggtgtgctgatagagatc
gtgcaggtcgatggcgcgacagtgactgctgagcagctgattgcgcgcatcgatacctcg
gccgcggctggcgctgccgcgcctgaagcggcgcctgcgccggctgctgctcccgcaccg
gctgccgcaccggcagcagccgctgctgctggtggcagcaaagccggtgtggccatgccc
gccgccgccaaattgatggccgacaacaagctcgcggccggcagcgtggccggctccggc
aaagacggccgcgtgaccaagggcgatgtgctggccgctgtggctggtggcggcgccaag
gcggtgtccgcgcccgtggccatccccactggtgcgcccaccaaggtgttgccgcaagtg
gccatggtggcccctgatctgggtgaccgtccggaagagcgcgtgcccatgacgcgtctg
cgtgcccgcgtggccgagcgcttgctgcagtcgcaggccaccaacgccatcctgaccacg
ttcaatgaaatcaacatggctccggtcatggagatgcgcaagcgcatgcaggagcgcttc
gaaaaagaacatggcgtcaagctggggttcatgagtttcttcgtcaaagcggctgtgcat
gcgctgaagaagtttcccgtgatcaacgcatcgatcgatggcaccgacatcgtgtaccac
ggttacttcgatatcggtatcgcggtgggctcgccccgtggtctggtggtgccgatcttg
cgcaacgccgaccagatgagctttgctgacatcgagaagaagatcgctgattttggccag
cgggccaaagacggcaagatcaccctggacgacatgaccgggggtactttctcgatttcc
aacggcggcaccttcggctccatgatgtccacccccatcatcaacccgccccagtcggcg
atcctcggcgtgcacgcaaccaaagagcgtgccatggtggagaacggccaggtcgtggtt
cgcccgatgaactacttcgccatgtcctatgaccaccgcatcatcgacggccgcgaagcc
gttctgggtctcgtggccatgaaggaagcgctggaagacccagcccgcctcctttttgat
atctga

DBGET integrated database retrieval system