KEGG   Hydrogenophaga sp. PAMC20947: E5678_07225Help
Entry
E5678_07225       CDS       T05960                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
hyc  Hydrogenophaga sp. PAMC20947
Brite
KEGG Orthology (KO) [BR:hyc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    E5678_07225 (ahpF)
Enzymes [BR:hyc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     E5678_07225 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored HI0933_like FAD_binding_3 AlaDh_PNT_C DAO Thi4 FMO-like K_oxygenase NAD_binding_8 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: QCB45828
UniProt: A0A4P7R8B3
LinkDB All DBs
Position
complement(1621418..1623016)
Genome map
AA seq 532 aa AA seqDB search
MLDVTLTGQLSTYLAMLRQPICLIASLDGSAKAAEMRELLGEIAALSDKVTVDESGSDGR
KPSFVIAREGESTGVRFAAIPLGHEFTSLVLALLWTGGHPPKVEPEVIEQIRALNGEHRF
EVYMSLSCHNCPDVVQAASLMAILNPNIQTVVIDGGLFQEEVERRQVLAVPLVYRNDEVF
GSGRMLLEEMVAKLDVKSDEREAAKLNQKDPFDVLIVGGGPAGAAAAVYAARKGIRVGVA
AERFGGQVNDTMAIENYISVQETDGPKFAAALEAQVRHYDVDIMNLQRADKLIPASEPGG
FIEVQLANGGSLKSKSVILSTGARWRNVNVPGEQEYKNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAQVTLVEFADALKADAVLVSKLKSLPNVAIHVNAQTTEIMGAH
GKVNGLRYKDRLSGVEQLVELEGVFVQIGLVPNTEWLEGDVALSRFGEIEVDAKGHTNVP
GVFAAGDCTTVPYKQIVIAAGEGSKAALSAFDHLIRLPVVTPVASEVSESVG
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacgtcaccctcacaggccagctttccacctacctggcgatgctccgccagccc
atttgcctgatcgcttcgctcgacggcagcgccaaggcggctgagatgcgggaattgctg
ggcgagatcgccgccttgtcggacaaagtgactgttgacgagtcgggctcggatggccgc
aagccctcgtttgtgatcgcccgcgaaggcgagagcaccggtgttcgtttcgcggcaatt
ccgctgggccacgaattcacatcgctggtgctggccttgctgtggacgggtgggcaccca
cccaaggtcgagcctgaggtgattgagcagatcagggcgctgaacggtgagcaccgcttc
gaggtgtacatgagcctgtcctgccacaactgtcccgacgtggtgcaggcggcgagcttg
atggccatcttgaacccgaatatccagactgtggtgatcgatggtggcctgttccaggaa
gaggtcgagcgccgtcaggtgctggccgtgccgctggtgtaccgcaacgacgaggtgttc
gggtcgggccgcatgctgctggaagagatggtggccaagctggatgtgaagtccgatgag
cgtgaagccgccaagctcaaccagaaagatccgtttgatgtgctgatcgtgggcggtggc
ccagccggtgccgctgcggcggtctatgccgctcgcaaaggtatccgggtgggtgtggcc
gctgagcgtttcggggggcaggtgaacgacaccatggccatcgaaaactacatcagcgtg
caggaaacggacggcccgaagttcgcggcagcgctggaggcgcaggtgcgccactacgac
gtggacatcatgaacctgcagcgggcagacaaattgattccggccagcgagccggggggg
ttcatcgaggtgcagctggcgaacggcgggtcgctcaagagcaagagcgtgatcctttca
accggcgcgcgctggaggaatgtcaacgtacccggcgagcaggaatacaagaacaagggt
gtggcctattgcccccattgcgacggcccgctgttcaagggcaaacgcgtggcggtgatc
ggcggcggcaactcgggtgtcgaggcggcgattgatctggccggcatcgtggcccaggta
accttggtggaatttgccgacgcactgaaggccgatgcggttctggtgagcaaactcaag
agcttgccgaacgtcgccatccatgtgaacgcacagaccaccgaaatcatgggtgcccat
ggcaaggtgaacggcttgcgctacaaggaccgtttgagtggcgtcgagcagctggtcgag
ctggaaggtgtattcgttcagatcgggctggtgcccaacaccgaatggctcgagggtgat
gtggcgctgagccgttttggtgagatcgaggtcgacgccaagggtcacaccaatgtgccc
ggtgtgttcgcggcgggtgattgcaccaccgtgccttacaagcagatcgtgatcgctgcg
ggagagggctccaaagcagccctcagcgcgtttgaccacctgattcgcctgcccgtcgtg
acgcctgtggcaagcgaggtgtcggaatccgtgggttga

DBGET integrated database retrieval system