KEGG   Hydrogenophaga sp. PAMC20947: E5678_12100Help
Entry
E5678_12100       CDS       T05960                                 

Definition
(GenBank) glutathione S-transferase
  KO
K03599  stringent starvation protein A
Organism
hyc  Hydrogenophaga sp. PAMC20947
Brite
KEGG Orthology (KO) [BR:hyc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hyc03021]
    E5678_12100
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hyc02000]
    E5678_12100
Transcription machinery [BR:hyc03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     E5678_12100
Transporters [BR:hyc02000]
 Other Transporters
  Pores ion channels [TC:1]
   E5678_12100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C Glutaredoxin GST_C_3 GST_C_5
Motif
Other DBs
NCBI-ProteinID: QCB46701
LinkDB All DBs
Position
complement(2688441..2689052)
Genome map
AA seq 203 aa AA seqDB search
MMVLYSGTTCPYSHRCRFVLFEKGMDFEIRDVDLYNKPEDISVMNPYGQVPILVERDLIL
YESNIINEYIDERFPHPQLMPGDPVDRARVRLFLLNFEKELFAHVSVLEARSVKGNEKAL
EKARSHIRDRLTQLAPVFLKNKFMLGDNFSMLDVAIAPLLWRLDFYGIELSKNAAPLLKY
AERIFSRPAYIEALTPSEKVMRK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatggttttgtattcgggtactacttgcccttactcccaccgttgccgtttcgtcttg
ttcgaaaagggcatggactttgaaattcgggatgtggacctctacaacaagcccgaagac
atcagtgtgatgaacccttacgggcaggtgcccattttggtcgaacgcgacttgatcctc
tacgaatcgaacatcatcaatgagtacatcgatgagcgatttccccatccgcagctgatg
cccggcgacccggtggatcgcgcgcgcgtccgtctgttcttgctcaactttgagaaagaa
ctgttcgcccatgtttccgtgctcgaggcgcgcagcgtcaaaggcaatgaaaaggcactg
gaaaaggcccgctcgcatattcgcgaccgcctgacccagctggcgcccgtgttcctgaaa
aacaaattcatgctcggcgataacttctcgatgctggacgtcgccatcgcacccttgctc
tggcgcctcgacttctacggcattgagctgagcaaaaatgcagcgccgttgctgaaatac
gccgagcgtattttttcacgccctgcctacatcgaagcgctcacaccttctgaaaaggtg
atgcgcaagtaa

DBGET integrated database retrieval system