KEGG   Hymenobacter sp. DG25B: PK28_02690Help
Entry
PK28_02690        CDS       T03500                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
hyd  Hymenobacter sp. DG25B
Pathway
hyd00380  Tryptophan metabolism
hyd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hyd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    PK28_02690
Enzymes [BR:hyd01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     PK28_02690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AIZ62863
UniProt: A0A0A7LKB7
LinkDB All DBs
Position
618681..619964
Genome map
AA seq 427 aa AA seqDB search
MTFEPTPEFAAHLDAQDPLHLFRTQFHIPPGPEGGEAVYLCGNSLGLLPRAARAAVEEEF
ASWEERAVEGHFLGAMPWMHYHENLTAATARLVGAQPVEVVVMNSLTVNLHLLLISFYRP
TTSRYKVLMEGGAFPSDQYALESQVKLHGYQPEEAIVELVPRPGEHTLRTEDIEAKIQEL
GDSLATVILGGVNYYTGQAFDMAAITRAGHAVGAMVGFDLAHAAGNLLLHLHDWDVDFAC
WCSYKYLNSGPGGTSGVFVHERFANRPDLPRLAGWWGHDPADRFQMKKGFRPMPGAAGWQ
LSNAQIFPMAIHRVALNLVEEAGGMPALRQKSEQLTAYLEFLIRRLELAKDVLEIITPPD
PAQRGCQLSLLVHRNGRELFEHLASVGIMADWREPNVIRMAPVPLYNTFADVQRAGAALA
DWSRWAE
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcgagcctactcccgaattcgctgcccacctagacgcgcaggatccgctgcat
ttgttccgtactcagttccacattccccctggtcctgaagggggagaagcggtgtacctg
tgcggcaactccctggggcttttgccccgcgctgcccgcgccgccgtggaggaggagttt
gcctcctgggaagagcgcgccgtggaaggccatttcctgggcgctatgccttggatgcac
taccacgaaaacctgacggcggccaccgcccggctggtaggcgcccagcccgtggaagtg
gtagtgatgaacagcctcaccgtgaacctgcatctgctgctgatttccttctaccggccc
accacctcgcgctacaaagtactgatggaaggcggcgctttcccttcggatcagtacgcc
ttggagtcgcaggtgaagctgcacggctaccagcccgaggaggccattgtggagctggtg
ccgcgccccggcgagcacacgctgcgcaccgaggacattgaagccaaaattcaggagctg
ggcgattcgctggctaccgtgattctgggtggcgtgaactactacaccgggcaggccttt
gatatggctgcaatcacgcgggccggccacgccgtaggggccatggtcggcttcgacctg
gcccacgccgccggcaacctgctgctgcacctgcacgactgggacgtagactttgcctgc
tggtgctcctacaaataccttaactccggccccggcggcaccagtggcgtgttcgtgcac
gagcggtttgccaaccgccccgatctgccacgcctggccggctggtggggccacgacccc
gccgaccgttttcagatgaaaaaaggcttccggcccatgcccggcgcggccggctggcag
ctctccaacgcccagattttccccatggccatccaccgcgtggccctcaacctggtggag
gaagcaggcggcatgccggcgctgcggcaaaagagcgagcagctcacggcttacctcgag
tttctgattcggcgcctggaactggccaaggatgtcctcgaaattattaccccgcccgac
cccgcccagcgcggctgccagctttctctgctggtgcaccgcaacggccgcgagctgttt
gagcacctggccagcgtgggcataatggccgactggcgcgagcctaacgttattcggatg
gcgcccgtgccgctgtacaataccttcgccgatgtccagcgcgccggtgcggccctggcc
gattggtcgcgctgggcggaataa

DBGET integrated database retrieval system