KEGG   Hymenobacter sp. DG25B: PK28_03840Help
Entry
PK28_03840        CDS       T03500                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
hyd  Hymenobacter sp. DG25B
Pathway
hyd00071  Fatty acid degradation
hyd00280  Valine, leucine and isoleucine degradation
hyd00281  Geraniol degradation
hyd00362  Benzoate degradation
hyd00592  alpha-Linolenic acid metabolism
hyd01100  Metabolic pathways
hyd01110  Biosynthesis of secondary metabolites
hyd01120  Microbial metabolism in diverse environments
hyd01130  Biosynthesis of antibiotics
hyd01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:hyd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PK28_03840
   00592 alpha-Linolenic acid metabolism
    PK28_03840
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PK28_03840
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    PK28_03840
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PK28_03840
   00642 Ethylbenzene degradation
    PK28_03840
Enzymes [BR:hyd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     PK28_03840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIZ63039
UniProt: A0A0A7LIP1
LinkDB All DBs
Position
887850..889028
Genome map
AA seq 392 aa AA seqDB search
MNAYIVAGYRTAVGKANRGGFRFTRPDDLAADVIKHLVASVPALDPTRIDDVIVGNAVPE
AEQGLQMGRLISLLALPMNVSGLIVNRYCGSGVETIAMAAGKIAAGMADCIVAGGTESMS
LVPTVGWKTVPNYKLAKEHPDYYLGMGLTAEAVAQDYKISREDQDQFSYNSHQKAIKAIQ
AGKFKEQIVPITVEETYLDPASGKKKTRSYVVDTDEGPRADTSVEALGKLRPVFAANGTV
TAGNSSQTSDGAAFVIVMSERMVKELNLEPIARMVTYATEGIDPRIMGMGPIKAIPKALK
QAGMKLEDIDLFELNEAFASQSLAVMRELGMDQSKVNVNGGAIALGHPLGCSGAKLSIQL
FHELRAQNKKYGMVTACVGGGQGVAGIYELLK
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcatatatcgtagctggttaccgtacggccgtaggcaaagccaaccgtggcggt
ttccgcttcacccgccccgatgacctggccgccgacgtcatcaagcacctggtggcctcc
gtgcccgccctcgaccccacgcgcatcgacgatgtgatagtgggcaatgccgtgccggaa
gccgagcagggcctgcaaatgggccgtctgatttcgctgctggctttgcccatgaacgta
tcaggccttattgtgaaccgctactgcggctccggggtagaaaccattgccatggccgcc
ggtaaaattgccgccggcatggccgactgcatcgtggccggtggtacggaaagcatgagc
ctggtgcccaccgtaggctggaaaacggtgcccaactacaagctggccaaagagcacccg
gactactacctcggcatgggcctcaccgccgaagccgtagcccaggactacaagatttcc
cgcgaagaccaggaccagttctcctacaactcccaccagaaggccattaaagccattcag
gccggcaagttcaaggaacagattgtgcccatcacggtagaagaaacttacctggacccc
gccagcggcaaaaagaaaacccgctcttacgtggtagataccgatgaaggcccccgtgct
gatacctcggtagaagccctgggcaagctgcgccccgtgtttgcagccaacggtaccgta
acggccggcaactcctcccagacttccgatggcgctgccttcgtcattgtgatgtcggag
cgcatggtgaaggagctgaacctggagcccattgcccgcatggtaacctacgccaccgaa
ggcattgacccgcgcatcatgggcatgggcccgattaaagccattccgaaggcactgaag
caggccggcatgaagctggaagacattgacttgttcgagctgaacgaggcttttgcttct
cagagtctggccgttatgcgcgagctgggcatggaccagagcaaagtgaacgtgaatggc
ggcgccattgcgctggggcacccactgggctgctcgggagccaagctcagcattcaactg
ttccacgagctgcgggcgcaaaacaagaaatacggcatggtaaccgcctgcgtgggcggc
ggccagggcgtagccggcatttatgaactgctgaaataa

DBGET integrated database retrieval system