KEGG   Hymenobacter sp. DG25B: PK28_07385Help
Entry
PK28_07385        CDS       T03500                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hyd  Hymenobacter sp. DG25B
Pathway
hyd00473  D-Alanine metabolism
hyd00550  Peptidoglycan biosynthesis
hyd01100  Metabolic pathways
hyd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hyd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PK28_07385
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PK28_07385
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    PK28_07385
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hyd01011]
    PK28_07385
Enzymes [BR:hyd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PK28_07385
Peptidoglycan biosynthesis and degradation proteins [BR:hyd01011]
 Precursor biosynthesis
  Amino acid ligase
   PK28_07385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_N Dala_Dala_lig_C ATP-grasp_4 ATP-grasp_3 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AIZ63558
UniProt: A0A0A7LM87
LinkDB All DBs
Position
complement(1721189..1723960)
Genome map
AA seq 923 aa AA seqDB search
MKIGIFFGGPSREREISFAGGRTVYDNLDKSLFQAVPVFVDSRGNFILLDWHYIYKGTIR
DFYPPVSALPASEHKLQVYLESLGELSLAQQDEIINQVGRRIQPQELSSLMDFAFLALHG
PGGEDGAIQGLLEWYGIPYSGSGVLPSAFGIDKIAQKKLLHALNRPTPEFRVVSAEEWDA
ADPAATLAYLERELGLPLVFKAPRQGSSIGISILRTANVEAFHRAMERSLFRKTVTRDDW
QRLSERDKIMWVQQLTDIREGIGLPVMLDADDEHIIYHPEALLNTLAERLQTAEQVRLTN
VDGETQVLVESFVQGREFSCIVVEDPNGQPLALPPTEIVKGEEMFDYRSKYLPGLARKIT
PIDLPEDEIQRIREACEEMFRTFGFQVYARLDGFISSQLPVAGSQISGEETGNSQPATEN
SIFLNDPNTTSGMLPASFFFHQAAEIGLNPSQFLTYLIRTSLAARRRAGMRPVQLQRLLR
GLDAAVAARGHEERQRIKVAVIMGGYSSERHISVESGRNIYEKLSSSIKYEPVPVFLTGN
NQDFRLYVLPINVMLKDNADDIKEKVEHMEAGHSLHPILERIRREAEAITSTYAGQPTAQ
PRRVSFEELAKMVDEVFIALHGRPGEDGALQQQLEKFGLPYNGSGVGSSSITINKFETNR
RLREAGMRVAEHRMANRLEWQADAEGFYRSLETQFPYPFIAKPADDGCSSAVKKVKNRPE
LEAFTRLIFREQEDLMIPDAETLHLGFKEEFPRKDAFLVETLIERDGAAHFLEITGGLLT
HWRSDGQLDIEVFEASEALATGEVLSLEEKFLAGEGQNITPARYAADAIERQRISDEVKE
ELRRVAEILNIQGYARIDAFVRVRDNGAVEVIIIEVNSLPGMTPATCIFHQTALAGYTPY
DFIDQILEFGKERTRKEKLAVNS
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataggcatcttcttcggcggaccgtcgcgtgagcgggaaatttcctttgcgggc
ggccgcactgtatatgataacctggacaagtcgctgtttcaggccgttcccgtattcgtg
gacagccgcggcaacttcatcctgctggactggcactacatttataaaggcaccatccgg
gacttttatccgcccgtttcggccctgcctgcctccgaacacaagctgcaggtgtacctg
gaaagcctgggcgagctgagccttgcccaacaggacgaaattatcaatcaggtaggccgc
cgtattcagccgcaggagctgagcagcctcatggattttgccttcctggctctgcatggt
cccggcggcgaagatggcgctattcagggcctgctggagtggtacggcattccgtattcc
ggctccggcgtgctgccctcggcctttggcatcgataaaattgcccagaaaaagctgctc
cacgccctgaaccggcccacgccggagttccgcgtggtatcggccgaagaatgggacgcc
gccgacccggctgctaccctggcttacctggagcgcgagctgggcttgccgctggtgttc
aaagccccgcgccagggcagcagcattggcatcagcattctgcgcaccgccaacgtggag
gctttccaccgcgccatggagcgcagcctgttccgcaaaaccgtgacccgcgacgattgg
cagcgcctctcggagcgcgacaaaatcatgtgggtgcagcagctcaccgacatccgtgag
ggcattggcctgcccgtgatgttggatgccgatgatgagcacattatctaccaccccgag
gccctgctaaacacgctggctgagcgcctgcaaaccgccgaacaggtgcgcctgaccaac
gtggacggcgaaacccaggtgctggtggaaagctttgtacagggccgcgagttttcctgc
attgtggtggaagaccccaacggtcagccactggcgctgccgcccacggagattgtgaag
ggcgaggagatgttcgactaccgctcgaaatacctgcccggcctggcccgcaaaatcacc
cccatcgatttaccggaagacgaaattcagcgcatccgggaagcctgtgaggagatgttc
cgcacgttcggcttccaggtgtacgcgcggctggatgggtttatcagttcccagttacca
gttgccggttcccagatttcaggtgaagaaactggcaactcgcaaccggcaactgaaaac
tccattttcctcaacgacccgaacaccacgtcgggcatgttgccggcctcgttcttcttc
caccaggcggcggaaatcgggctcaatccttcgcagtttctgacctatctgattcgcact
tctctggcagcacgccgccgggcgggtatgcggcccgtacagctgcagcgcctgctgcgt
gggctggatgcggccgtagctgcccgcgggcacgaggagcgtcagcgcattaaagtggcc
gtcattatgggcggctattcttcggagcgccacatttcggtggaaagcggccgcaacatc
tacgagaagctcagctcctctattaagtatgagccggtgcccgtattcctgaccggcaac
aaccaggatttccgcctgtacgtgctgcctatcaacgtcatgctgaaggacaacgccgac
gacatcaaggagaaagtggagcacatggaggcgggccacagcctgcaccctattctggag
cgcatccgccgcgaagcagaagccattaccagcacctatgccggtcagcctaccgcgcag
ccgcgccgggtatcgtttgaggaactggccaagatggtagatgaggtgtttattgccctg
cacggtcgtcccggcgaggacggtgctttgcagcagcaactggaaaagttcggcctgccc
tacaacggctcgggcgtgggcagcagcagtatcaccatcaataagtttgaaaccaaccgc
cgcctgcgcgaagccggcatgcgtgtggccgagcaccgcatggccaaccgcctggaatgg
caggccgatgccgagggcttctaccgctccctggaaacgcagtttccctaccccttcatt
gccaagcccgccgacgacggctgctcttcggcggtgaaaaaagtaaagaaccgccctgag
ctggaggctttcacccgcctcatcttccgggagcaggaagacctgatgatacccgatgcc
gaaacgctgcacttaggcttcaaggaggaattcccccgcaaggacgccttcttggtagaa
accttgattgagcgcgacggcgcggctcacttcctcgaaattacgggcggtctgctcacc
cactggcgctccgatgggcagctggacattgaggtttttgaggcttccgaagcgctggct
accggtgaggtattgagcctggaggagaagttcctggccggcgaaggccagaacatcacc
ccggcccgctacgccgccgatgccattgagcgccagcgcatttccgacgaggtgaaggaa
gagctacgccgcgtggccgaaatcctgaacattcagggctacgcccgcatcgacgcgttt
gtgcgggtgcgcgacaacggcgcagtggaggtcatcatcatcgaggtaaactccctgccc
ggcatgacgcccgccacctgcatcttccatcaaaccgcgctggccggctacacgccctac
gatttcatcgaccagattctggagttcggcaaagagcgcacccgtaaagaaaagctggcg
gtgaacagctaa

DBGET integrated database retrieval system