KEGG   Hymenobacter sp. DG25B: PK28_11185Help
Entry
PK28_11185        CDS       T03500                                 

Definition
(GenBank) peptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
hyd  Hymenobacter sp. DG25B
Brite
KEGG Orthology (KO) [BR:hyd00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hyd01002]
    PK28_11185
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hyd04147]
    PK28_11185
   04090 CD Molecules [BR:hyd04090]
    PK28_11185
Enzymes [BR:hyd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     PK28_11185
Peptidases [BR:hyd01002]
 Metallo Peptidases
  Family M2
   PK28_11185
Exosome [BR:hyd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PK28_11185
CD molecules [BR:hyd04090]
 Proteins
  PK28_11185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2 Peptidase_M32
Motif
Other DBs
NCBI-ProteinID: AIZ64116
UniProt: A0A0A7LL89
LinkDB All DBs
Position
2618324..2620183
Genome map
AA seq 619 aa AA seqDB search
MKKTLLSGLAFAALGTGVWSCATTSKAPVATTPAPTETAPVAAAPSWSQQADDFLKSYSA
EYQRLYTASAEAEWRSNTHIVAGDTANSGATTRANERMAAFTGSAENIKRLRELLDHKAD
LSELQVKQLQTALYNAANSPQTIAEVVKRRIKAEAAQTEKLYGFDYKYQGKSVTTNDLDE
LLRKEKNPAKRQQIWEASKAIGPTLKDGLLNLRDLRNQTVQALGYPDYFTYQASDYGMTR
EEMMALVRKINDELRPLYRELHTYARYELAKKYNVKQVPDYLPASWLPNRWGQDWSAMVD
VKGLNIDPILAKKGAEWQVKQAERFYQSLGFPALPASFYEKSSLYPLPKDAGYKKNNHAS
AWHMDLDHDVRSLMSVEGNTEWYETTHHELGHIYYYLTYTNPEVPVLLRGGANRAYHEAM
GSLMGLAATQKPFLAGLNLVDPKTQTDQTQTLLKEALNYAVFIPFASGVMSEWENSFYAD
KLPADQLNARWWALAKQYQGIVPPTTRGEQYLDPATKTHINDDPAQYYDYALSYVILFQL
HDHMAKKILKQDPHATNYYGSKEVGQFLADIMRPGASKDWRTVLKEKTGEDLSARAMVDY
FQPLMAYLKQQNKGRKYTM
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaccttgttatccggcctggccttcgcggcgctgggtacgggcgtatggtcg
tgtgctactaccagcaaggcgcccgtagctactaccccggcccccaccgaaacggcgccg
gttgcggccgccccttcctggagccagcaggccgatgattttctgaagtcttactccgcc
gaataccagcgcctctacaccgcctcggcggaagcggaatggcgctccaacacgcatatt
gtggctggcgacacggccaactccggagccaccacccgcgctaatgagcgcatggccgcc
ttcaccggctcggcagagaatatcaagcgcctgcgggaactgctcgaccacaaagctgac
ctcagcgagctgcaggtaaagcagctgcaaacggcgctgtacaacgccgccaactcgccc
cagaccattgccgaggtggtgaagcgccgcattaaggccgaagccgcccaaacagaaaag
ctctacggtttcgactacaagtaccagggcaaatccgtgaccaccaacgacctggacgag
ctcctgcgcaaggaaaaaaacccggctaagcgccagcagatctgggaagccagcaaagcc
attggccccacgctgaaagatggcctgctgaacctgcgcgacctgcgcaaccagaccgtg
caggccctgggctaccccgactacttcacctaccaggcctccgactacggcatgacccgc
gaggagatgatggcgctggtccgcaaaataaacgacgagctgcgcccgctttaccgggag
ctgcacacctacgcccgctacgagctggccaagaagtacaacgtgaagcaggtgcccgac
tatctgccggcttcctggctgcccaaccgttggggccaggactggagcgccatggtagac
gtgaaaggcctgaacatcgaccccatactggccaaaaagggggctgagtggcaggtaaag
caggccgagcgcttctaccagagcctgggcttcccggccctgcccgcttcgttctacgaa
aagtcgagcctgtacccgctgcctaaagatgccgggtacaaaaagaacaaccacgcctcg
gcctggcatatggacctggaccacgatgtgcgcagcctgatgagcgtggaaggcaacacc
gagtggtacgaaaccacccaccacgagctggggcacatttactactacctcacttacacc
aaccccgaggtgcccgtgctgctgcgcggtggtgctaaccgggcctaccatgaggccatg
ggcagcctcatgggcctggccgctacccaaaagccctttctggcgggcctgaatctggta
gaccccaaaacccagaccgaccagacccagacgctgctgaaggaagccctgaactatgcc
gtgttcattccctttgcttcgggggtgatgagtgagtgggaaaacagcttctatgccgat
aagctccccgccgaccagctgaatgcccgctggtgggccctggccaagcagtaccagggt
attgtgccgcccaccacgcgcggcgagcagtacctggaccccgccaccaaaacccacatc
aacgacgaccccgcgcagtactatgactacgcgctgagctacgttatcctgttccagctg
cacgaccacatggccaagaaaattctgaagcaggacccgcacgctaccaactactacgga
agtaaagaggtggggcagtttctggccgacattatgcgccccggcgccagcaaagactgg
cgcacggtgctgaaagagaaaaccggcgaagacctttctgcccgcgccatggtagattat
ttccagccgctgatggcttacctgaagcagcagaacaaaggccggaagtacaccatgtaa

DBGET integrated database retrieval system