KEGG   Hymenobacter sp. DG25A: AM218_08830Help
Entry
AM218_08830       CDS       T04064                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hye  Hymenobacter sp. DG25A
Pathway
hye00473  D-Alanine metabolism
hye00550  Peptidoglycan biosynthesis
hye01100  Metabolic pathways
hye01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hye00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AM218_08830
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AM218_08830
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AM218_08830
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hye01011]
    AM218_08830
Enzymes [BR:hye01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AM218_08830
Peptidoglycan biosynthesis and degradation proteins [BR:hye01011]
 Precursor biosynthesis
  Amino acid ligase
   AM218_08830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ALD21300
UniProt: A0A0M4HE03
LinkDB All DBs
Position
2067890..2070598
Genome map
AA seq 902 aa AA seqDB search
MKIGIFFGGPSREREISFAGGRTVYDNLDKSLFQAVPVFVDSRGNFILLDWHYIYKGTIR
DFYPPVSALPSSEHKLQVYLESLGELSIAQQDEIINQVGRRIQPQELSSLMDFAFLALHG
PGGEDGAIQGLLEWYGIPYSGSGVLPSAFGIDKIAQKKLLHALNRPTPEFRVVTAEEWDA
ADPAATLAYLERELGLPLVFKAPRQGSSIGISILREAKVEAFQRAMERSLFRKTVTRDDW
QRLSERDKIMWVQQLTDIREGIGLPVMLDADDEHIIYHPEALLNTLAECLQTTEQVRLTN
VDGETQVLVESFVQGREFSCIVVEDSNGKPLALPPTEIVKGEEMFDYRSKYLPGLARKIT
PIDLPEDEIQRIRQACEEMFRTFGFQVYARLDGFLSTDNQLFLNDPNTTSGMLPASFFFH
QAAEIGLNPSQFLTYLIRTSLAARRRAGMRPVQLQRLLRGLDAAVAARGHEERQRIKVAV
IMGGYSSERHISVESGRNIYEKLSSSIKYEPVPVFLTGNSQDFRLYVLPINVMLKDNADD
IREKIEYAEAGHGLHPVLERIRREAQSITSTYAGQPTAQPRRVSFKDLAEMVDEVFIALH
GRPGEDGALQQQLEKFGLPYNGSGVGSSSITINKFETNRRLREAGLRVAEHRMANRLEWQ
ADAEGFYRSLETQFPYPFIAKPADDGCSSAVKKIKNRAELEAFTRLIFREQEDLMIPDAE
TLHLGFKEEFPRKDAFLVETLIERDGAAHFLEITGGLLTHWRADGKLDIEVFEASEALAI
GEVLSLEEKFLAGEGQNITPARYAADAIERQRISNEVKEELRRVAEILNIQGYARIDAFV
RVRDNGAVEVIIIEVNSLPGMTPATCIFHQTALAGYTPYDFIDQILEFGKERTRKEKLAV
GN
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataggcatcttcttcggcggaccgtcgcgtgagcgggaaatttcctttgctggc
ggccgcactgtatatgataacctggacaagtcgctgtttcaggccgttcccgtattcgtg
gacagccgcggcaacttcatcctgctggactggcactacatttataaaggcaccatccgg
gacttctacccgcctgtttcggccttgccgtcctccgagcacaagctgcaggtgtacctg
gaaagcctgggcgagctgagcattgcgcagcaggacgaaatcatcaaccaggtaggccgc
cgcattcagccgcaggagctgagcagccttatggatttcgctttcttggccctgcacggc
cccggcggcgaagatggcgctattcagggcctgctggagtggtacggcattccgtattcc
ggctccggcgtgctgccttcggcctttggtattgataaaattgcccagaaaaagctgctc
cacgccctgaaccggcccacgccagaattccgcgtggttacggccgaagagtgggacgcc
gctgacccggctgctacgctggcttacctggagcgcgagctgggcttgccgctggtgttc
aaggctccgcgccaaggcagcagcattggcatcagcattctgcgcgaagccaaagtggaa
gctttccagcgcgccatggagcgcagcctgttccgcaaaaccgtgacccgcgacgactgg
cagcgcctctcggagcgcgacaaaatcatgtgggtgcagcagctcaccgacatccgcgaa
ggcattggcctgcccgtgatgctggatgctgatgatgagcacatcatctaccaccccgaa
gccctgctgaacacgctggcagagtgcctgcaaaccaccgagcaggtgcgcctgaccaat
gtggacggcgaaacccaggtgctggtggaaagcttcgtacaaggccgcgagttctcctgc
attgtggtggaagactccaacggtaagccactggcgctgccgcccacggaaattgtgaag
ggcgaggagatgttcgactaccgctcgaaatacctgcccggcctagcccgcaaaatcacc
cccatcgatttgccggaagacgaaattcagcgcatccgccaggcctgtgaggagatgttc
cgcacgttcggcttccaggtgtacgcgcgtctggatggcttcctgtccacggataaccag
ctgttcctcaacgacccgaacaccacatcgggcatgttgccggcttccttcttcttccac
caggcggcagaaatcgggctcaatccttcccagttcctgacctatctgattcgcacctcg
ctggcagcacgccgccgggcgggcatgcggcctgtgcagctgcagcgcttgctgcgcggg
ctggatgcagccgtggctgcccgcggacacgaggagcgtcagcgcattaaagttgccgtc
attatgggcggctactcctcagagcgccacatttcggtggaaagcggccggaacatctat
gagaagctcagctcctctataaagtacgagccagtgccggtgttcctgaccggcaacagc
caggatttccgcctgtacgtgctgcccattaacgtaatgctgaaggacaacgccgacgac
attcgggagaagattgagtacgcggaagcgggccacggtctgcacccggtactggaacgc
atccgccgtgaggcccagagcattactagtacgtatgcaggtcagccgaccgcgcagccg
cgccgggtgtcgtttaaggatctggccgagatggtggatgaggtattcattgcgctgcac
ggtcgtcccggcgaggatggggcgttgcagcagcagctggagaagtttggcctgccgtac
aatggctcgggcgtgggcagcagcagcattaccatcaataagttcgaaaccaaccgacgc
ctgcgcgaagccggcctgcgcgtggccgagcaccgcatggccaaccgcctggaatggcag
gccgatgccgaaggcttctaccgctccctggaaacgcagttcccctaccccttcattgcc
aagcccgccgatgatggctgctcttcggcggtgaaaaaaataaagaaccgcgccgagctg
gaagccttcacgcgcctcatcttccgcgaacaggaagacctgatgattccggatgccgaa
acgctgcacctgggctttaaggaggaattcccccgcaaggatgctttcttggtggaaacc
ctgattgagcgcgacggcgcggcccacttcctcgaaattacgggcggcctgctcacgcac
tggcgcgccgatggcaagctggatattgaggtttttgaggcttccgaagccctggctatc
ggcgaagtattgagcctggaggagaaattcctggccggcgaaggccagaacattactccg
gcccgttatgctgcagatgctattgagcgccagcgcatttccaacgaggtaaaggaagaa
ctgcgccgcgtggccgaaatcctgaatattcagggctacgcccgcatcgacgcctttgtg
cgggtgcgcgacaacggcgcggtggaggttatcatcattgaggtgaactccctgcccggc
atgacgcccgctacctgcatcttccaccaaaccgcgctggccggctacacaccctacgat
ttcatcgaccagattctggagttcggcaaagagcgcacccgcaaagagaagctggcggtt
ggcaattag

DBGET integrated database retrieval system