KEGG   Hymenobacter sp. DG25A: AM218_12610Help
Entry
AM218_12610       CDS       T04064                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
hye  Hymenobacter sp. DG25A
Pathway
hye00473  D-Alanine metabolism
hye01100  Metabolic pathways
hye01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hye00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AM218_12610
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    AM218_12610
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hye01011]
    AM218_12610
Enzymes [BR:hye01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AM218_12610
Peptidoglycan biosynthesis and degradation proteins [BR:hye01011]
 Precursor biosynthesis
  Racemase
   AM218_12610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: ALD21892
UniProt: A0A0M4HQ12
LinkDB All DBs
Position
complement(2930721..2933219)
Genome map
AA seq 832 aa AA seqDB search
MLLFSHLPDITGGTLLPTPAALHRPVQHLLLDSRHVGVAAGALFFAIRGAQHNGHRYLPD
LYQQGVRQFVVDRAEEIPQGLEAYPEACFLLVADSLLALQTVAAHHRLQFHVPVVGITGS
NGKTIVKEWLAQMLSPDELICKSPRSYNSQVGVPLSVWELNSTHTFGIFEAGISERGEME
RLARVIQPTLGIFTNLGTAHDAGFTSATEKAREKMRLFAGVDTLFYCRDHALVHAIAQEV
LDESRTFTWSRQHPQQAHVAVTVAEASADRTVVHVALDRPLPQEYTFTVPFADEPSLENA
LHVLTVLLWLQVPATEIQHRLDRLHPVAMRLEMKQALNDCYILDDTYNNDLAGLSLALDM
LARQPRRGRRSLILSDLLESGLPAAELYARVATQLATHGVERLLGVGPDISAHAEVFQDI
DKEFFADTEAFLTQVRPEQFRHETILVKGARRFGFERIVSAFQQKIHGTVLEVNFDALVH
NLNFYRTRLQPGTKLMVMVKAFAYGSGSYEVANLLQFHRADYLAVAYTDEGVELREQGIS
LPLMVMNPSPDSFQKMHQYHLEPEIYSFEVLQQYLAVAAEQPLPAIHLKLDTGMRRLGFA
EEDMPQLCALLRANADRLRVASALTHLAGADEEQHNSFSQQQLAAFSRMTPLVEAALGYS
IIKHALNSAGILRFPQAHFDMVRLGIGLYGVEATGQEQEALRPVSTLRTTVSQVKTLAAG
QTVGYGRRGSATAHDRRIATLAIGYADGYDRRFGNGGGEVVIRGQRAPIVGNVCMDMCMA
DVTHITGAQAGDTAEVFGPGITLSELATRIGTIPYELLTNVSERVKRVFFAE
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atgctgctattctcccacctgcccgatattaccggcggtacgttgctgccaacgcccgcc
gctctgcaccgccccgtgcaacacctgctgctggatagccggcacgtgggcgtagcggcc
ggggcgctgttctttgctattcggggtgcccagcacaatggacaccgttacctgccggac
ctgtatcagcagggcgtgcgccagtttgtggtagaccgcgccgaagaaattccccagggc
ctggaagcctacccggaagcctgctttttgctggtagccgatagcctgctggccctgcag
accgtagcagcgcatcaccgcctgcaattccacgtgcccgtggtaggcattacgggttcc
aatggcaaaaccattgtgaaagaatggctggcccagatgctgagccccgatgagctgatc
tgcaaaagcccgcgcagctataactcccaggtaggcgtgcccttgagcgtatgggagctg
aacagcacccacacttttggtatttttgaagccggtatttccgagcggggagagatggaa
cggctggcccgcgtaattcagcccacactgggtattttcaccaacctgggcaccgcgcac
gatgccggctttacctccgccaccgagaaagcgcgggagaaaatgcgcctttttgccggc
gtcgatacgctgttctactgccgcgaccacgccctggtgcatgcaatagcgcaggaagtg
ctggatgagtcccgcacgtttacctggagccgacagcacccgcagcaggcccacgtagcc
gttaccgtagccgaagccagcgccgaccgcaccgtggtgcacgtagcgctggaccgcccc
ctgccgcaggaatacaccttcacggtgcccttcgccgacgagccttccctggaaaatgcg
ctgcacgtgcttaccgtactgctctggctgcaggtgccggccaccgaaattcagcaccgt
ctggataggctgcaccccgtggccatgcgcctggaaatgaagcaggccctgaacgactgc
tacattctggatgacacctataacaacgacttagccggcctctcgctggcgctggatatg
ctggcccgccagccgcgacggggccgccgcagcctgatcctgtctgatttactggaatcc
gggctgccggcggcggaactatacgcccgtgtggccacgcagctggccacgcacggcgta
gagcgcctgttgggcgtaggacccgatatcagtgcccacgccgaggtttttcaggatata
gacaaagagttttttgcggatactgaagcgttcctgacgcaggtgcgacccgagcagttt
cgccacgaaaccattctggtgaaaggcgcccgccggttcggctttgagcggattgtgtcc
gcgtttcagcagaaaatccacggcacggtgctggaagtgaattttgatgccctggtgcac
aacctcaacttttaccgcacgcgcctgcagcccggcactaagctcatggtgatggtaaag
gcctttgcctacggcagcggcagctacgaagtggccaatctgctgcagttccaccgcgcc
gattacctggccgtggcttacaccgatgaaggcgtggagctgcgcgagcaaggcatcagc
ctgccgctgatggtcatgaacccctcgcccgacagcttccaaaagatgcaccagtaccat
ctggagcccgaaatctactcgtttgaggtgttgcagcagtacttggccgtagccgccgaa
cagccgctgccggccattcacttaaagctggataccggcatgcgccgcctgggttttgcc
gaggaagatatgccgcagctgtgcgccctgctgcgcgccaacgccgaccggctgcgcgta
gccagcgccctcacgcacctggccggcgccgatgaggagcagcacaatagcttctcgcag
cagcagctggcagcctttagccgtatgacgccgctggtagaagcggcgctgggctattcc
atcatcaaacacgccctcaactcagccggcattctgcgcttcccgcaggcccatttcgat
atggtacggctgggcatcgggctgtatggggtagaggccaccgggcaggagcaggaagcg
ctgcggcccgtgagtacgctgcgcaccaccgtatcccaggtgaaaacgctggcggcgggg
caaacggtggggtatggccggcgcggctcagctaccgcccacgaccgccgcatcgccacc
ctagctatcggctacgccgatggctacgaccggcgcttcgggaacggaggcggagaggtg
gttatccgtgggcaacgggcgcctattgtcggcaatgtgtgtatggatatgtgcatggcc
gacgtcacccacattaccggcgcccaggccggcgacacggccgaggtatttggtccaggc
atcacgctttccgagttggccacccgcatcggcaccattccttacgagttgctgaccaac
gtaagtgagcgggtgaaaagagtgttttttgctgagtaa

DBGET integrated database retrieval system