KEGG   Hymenobacter sp. DG25A: AM218_13445Help
Entry
AM218_13445       CDS       T04064                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
hye  Hymenobacter sp. DG25A
Pathway
hye00380  Tryptophan metabolism
hye01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hye00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    AM218_13445
Enzymes [BR:hye01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     AM218_13445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ALD22031
UniProt: A0A0M4HLU8
LinkDB All DBs
Position
complement(3133737..3135020)
Genome map
AA seq 427 aa AA seqDB search
MTFEPTPEFAAHLDAQDPLHLFRNLFHIPPGPEGEEAVYLCGNSLGLLPRAARAAVEEEF
ASWEERAVEGHFLGAMPWMHYHENLTAATARLVGAKPVEVVVMNSLTVNLHLLLISFYRP
TTSRYKVLMEGGAFPSDQYALESQVKLHGYQPDEAIVELVPRPGEHTLRTEDIEAKIQEL
GDSLATVILGGVNYYTGQAFDMAAITQAGHAVGAIVGFDLAHAAGNLLLHLHDWDVDFAC
WCSYKYLNSGPGGTSGVFVHERFANRPDLPRLAGWWGHDPADRFQMKKGFRPMPGAAGWQ
LSNAQIFPMAIHRVALNLVDEAGGMPALRRKSEQLTAYLEFMICRLQLPKEVLEILTPQD
PAQRGCQLSLLVHRNGRELFEHLASVGVMADWREPNVIRMAPVPLYNTFADVQRAGAALA
DWSLLAE
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcgagcctactcccgaattcgccgcccacctcgacgcgcaggatccgctgcac
ctgttccgcaacctgtttcatattccgccgggccctgaaggggaggaagcggtgtacctg
tgcggcaactcgctgggcttgctgccccgcgccgcccgcgctgccgtggaggaggaattt
gcctcctgggaagagcgcgccgtggaaggtcatttcttgggcgctatgccctggatgcac
taccacgaaaacctgacggcggctacggcccggctggtaggggccaaacccgtggaagtg
gtggtgatgaacagcctcacggttaacctgcatctgctgctgatttccttctaccggccc
accacctcgcgctacaaagtgctgatggaaggcggcgcttttccttcggatcagtatgcc
ttggagtcgcaggtaaagctgcacggctaccagcccgatgaggccattgtagagctggtg
ccgcgccccggggagcacacgctgcgcaccgaggatatcgaagccaaaattcaggagctg
ggcgattcgctggctaccgtgattctgggcggcgtgaactactacaccgggcaggccttt
gatatggccgccattacgcaggccggccacgccgtaggggccatagtgggcttcgacctg
gcccacgccgccggcaacctgctgctgcacctgcacgactgggacgtggactttgcctgc
tggtgctcctacaaatacctcaactctggccccggcggcaccagtggcgtgttcgtgcac
gagcggtttgccaaccgcccggatctgccacgcctggccggctggtggggccacgacccc
gccgaccgtttccagatgaaaaaaggcttccggcccatgcccggcgcggccggctggcag
ctgtccaacgcccagattttccccatggccatacaccgcgtggccctcaacctggtagac
gaggcgggcggcatgccggcgctgcggcgcaagagcgagcagctcacggcctacctggag
tttatgatttgtcgcctgcagttgcccaaggaagttctggaaatccttaccccgcaggac
cccgcccagcgcggctgtcagctttccctgctggtgcaccgcaacggccgcgagctgttt
gagcacctagccagcgtgggcgtgatggccgactggcgcgagcccaacgtcatccggatg
gcgcctgtgcccttgtataacacgtttgccgacgtacagcgcgccggcgcggccctggcc
gattggtcgcttttggcggaataa

DBGET integrated database retrieval system