KEGG   Hydromonas sp. F02: DTO96_101392Help
Entry
DTO96_101392      CDS       T05560                                 

Gene name
puuE
Definition
(GenBank) 4-aminobutyrate aminotransferase PuuE
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
hyf  Hydromonas sp. F02
Pathway
hyf00250  Alanine, aspartate and glutamate metabolism
hyf00410  beta-Alanine metabolism
hyf00640  Propanoate metabolism
hyf00650  Butanoate metabolism
hyf01100  Metabolic pathways
hyf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hyf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    DTO96_101392 (puuE)
   00650 Butanoate metabolism
    DTO96_101392 (puuE)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DTO96_101392 (puuE)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DTO96_101392 (puuE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hyf01007]
    DTO96_101392 (puuE)
Enzymes [BR:hyf01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     DTO96_101392 (puuE)
Amino acid related enzymes [BR:hyf01007]
 Aminotransferase (transaminase)
  Class III
   DTO96_101392 (puuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AXF85661
UniProt: A0A345DBC3
LinkDB All DBs
Position
complement(1521610..1522887)
Genome map
AA seq 425 aa AA seqDB search
MSNADLQTRKNAATPRGVGVMTDFYAARAENSELWDVEGRRFIDFAGGIAVLNTGHRHPK
QVAAITEQLNSFTHTAYQIVPYESYVSLAEKVNARTPGTHAKKTAFFTTGAEAVENAIKI
ARAATGRAGVIAFTGGFHGRTMMGMALTGKVAPYKIGFGPFPSEIYHVPFPVESHGVTEN
DSLKAIQNLFKADIEPTRVAAIILEPVQGEGGFYMASQSFMRALRALCDEHGILLIADEV
QTGFGRTGKLFAMEHYDVQADLTTFAKSLAGGMPLSGVCGRTEIMDAPAPGGLGGTYAGN
ALALASAHAVLDIIDSENLLDRANVLGDKLKARLNDLRAQVPQISDVRGPGAMNAVEFVD
AATGLPSPEFTQKVRVAALNKGLLLLSCGTYANVIRFLFPLTIQDSVFDEGMAILESVLI
EAAKA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatgctgatttacaaactcgcaagaatgctgccacaccacgcggtgttggcgtg
atgactgatttttatgccgctcgtgcagaaaactctgaattatgggatgttgaaggtcgt
cgtttcatcgacttcgctggtggtattgctgttttaaatacaggtcatcgccaccccaaa
caagtggctgccatcacagagcaattgaatagttttacacacaccgcttaccaaatcgtt
ccatacgaaagctatgtgtctttggctgagaaagtaaatgcacgtacacctggcacacac
gcaaagaaaactgcttttttcaccacaggtgcagaagccgttgaaaatgcgatcaaaatc
gcacgcgccgccacaggtcgtgcaggtgtgatcgctttcacgggtggtttccatggtcgc
acaatgatgggcatggcattgacaggtaaagtcgcaccatacaaaatcggatttggtcca
ttcccttcagaaatttaccatgtaccattcccagtcgaatcgcacggcgtgactgagaat
gattcacttaaagccattcaaaacttatttaaagccgacattgagccaacacgcgtagca
gccatcattcttgagcctgttcagggcgaaggcggcttttacatggcttctcaatcgttc
atgcgcgctttgcgtgcgttgtgtgatgaacatggcattttgttgatcgccgatgaagtt
caaacaggttttggccgtacgggtaaattgtttgctatggagcattatgacgtccaagct
gacttgaccacttttgctaaaagtttggcgggtggcatgcctttgtctggcgtgtgcggt
cgcactgaaatcatggatgcacccgcaccaggcggtttgggtggtacttatgctggcaat
gctttggctttggcttctgcacatgcagtattggacatcattgactcagaaaacttactt
gaccgtgccaatgtgttgggcgacaagcttaaagcgcgtttaaatgacttacgtgcgcaa
gtgcctcaaatttcagacgtgcgcggcccgggtgcgatgaatgcagttgaatttgttgat
gctgcgacaggcttgccttcaccagagttcacacaaaaagtacgcgtggcggctttaaat
aaaggcttattgttattgtcatgcggtacttatgccaatgtgattcgtttcctgttccct
ctgaccattcaagacagcgtattcgacgaaggcatggctattttggaatcggtactgatt
gaagcagctaaagcttaa

DBGET integrated database retrieval system