KEGG   Hydromonas sp. F02: DTO96_101491Help
Entry
DTO96_101491      CDS       T05560                                 

Gene name
proC_2
Definition
(GenBank) Pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
hyf  Hydromonas sp. F02
Pathway
hyf00330  Arginine and proline metabolism
hyf01100  Metabolic pathways
hyf01110  Biosynthesis of secondary metabolites
hyf01130  Biosynthesis of antibiotics
hyf01230  Biosynthesis of amino acids
Module
hyf_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:hyf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    DTO96_101491 (proC_2)
Enzymes [BR:hyf01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     DTO96_101491 (proC_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored ApbA Sacchrp_dh_NADP NAD_binding_2 Shikimate_DH NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: AXF85755
UniProt: A0A345DBL7
LinkDB All DBs
Position
complement(1638327..1639160)
Genome map
AA seq 277 aa AA seqDB search
MHTTPQIVFLGGGNMATAIITGMINQGGFAPQQIVVVEHNADHRDHLHRTLGVTAFENLA
AAVHLSPDVWILAVKPQSMKAALAELSPLVKADQVVLSIAAGLTIATLSEWLQKHKKVVR
TMPNTPALVGKGVTGIYAPLSIVSENEQVLINQILLAVGVNVWLQTEAEIDTIAAISGSG
PAYVFYVMEHLTAAARQLGFDEETAKLLVQNTFSGAVALADASEDPVDVLRERVTSKGGT
TAAALAVFNAQGIDQALIQGTQAATERARELAVELAK
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaacccctcaaatcgtgttcctcggcggtggcaacatggccacagccattatc
actggcatgatcaatcaaggtggtttcgcccctcagcaaattgtcgtggttgaacacaac
gcagatcaccgtgaccatttgcaccgcacattgggcgtgaccgcatttgaaaatctcgca
gcggccgtgcacctctcacccgacgtgtggattcttgcagtcaaacctcagagcatgaaa
gcggctttggctgagttgtcccctttggtgaaagccgatcaagtcgttctaagcatcgca
gcaggtttaaccatcgccactttgtccgaatggttacaaaagcataaaaaagtggtgcgc
accatgcccaatacacctgcacttgtgggtaaaggcgttacaggaatttatgcaccactg
agcattgtgagcgaaaacgagcaagtgctcatcaaccaaatcctcttagcggtgggcgtg
aatgtctggttacagacagaagctgaaattgacaccatcgccgccatctcaggctcaggt
ccagcatatgtattctatgtgatggagcacctcacagcagcggctcgtcaattgggtttt
gatgaagagactgccaagctgctcgtacaaaacacgttctcaggtgctgtggccttggcc
gacgcttcagaagatcctgtcgacgtgttacgcgagcgcgtcacatcaaaaggtgggaca
actgcagcggccttggccgtgttcaatgcccaaggcatcgatcaagcccttattcaaggg
actcaagctgcgactgaacgtgcccgcgagttggccgttgaattggcgaaataa

DBGET integrated database retrieval system