KEGG   Hydromonas sp. F02: DTO96_101885Help
Entry
DTO96_101885      CDS       T05560                                 

Gene name
glpD2
Definition
(GenBank) Glycerol-3-phosphate dehydrogenase 2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hyf  Hydromonas sp. F02
Pathway
hyf00564  Glycerophospholipid metabolism
hyf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hyf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DTO96_101885 (glpD2)
Enzymes [BR:hyf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DTO96_101885 (glpD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA NAD_binding_8 HI0933_like FAD_binding_3 Pyr_redox_2 Thi4 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AXF86144
UniProt: A0A345DCQ6
LinkDB All DBs
Position
complement(2089706..2091259)
Genome map
AA seq 517 aa AA seqDB search
MTRANIIQSIHDTAQWDVLVIGGGASGLGTALEAASRGYRTLLLEAEDYAKGTSSRSTKL
VHGGVRYLAQGNIPLVREALHERGVLKNNAPHVVHDMGFLIASYHWWTTPFYGLGLKVYD
LLAGRLNVRRSRFVSKAEALQHTPSLKQKGLKGGVLYFDGQFDDSRLAITLMRTLVDQGG
VALNHAPVTGLLKDNGRVVGATFRETETGENQSVRATVVINATGVFVDDIRRMENPDVKA
MLSPSQGVHVVVDRRFLSGDSALMIPKTEDGRVLFAVPWHGHVLIGTTDTAVPHVSTEPR
ALPEEIEFILRTAAQYLEPAPTRADVLSVYAGLRPLVKAEEGTQTKSLSRDHVIRVSEGG
MITLTGGKWTTYRRMGMDTVDKAVELHGLAERPSVTEQLRLHGWADDAPADHWQVYGSDA
RSIQALDGAQTLLDARLPYVEAEVRWAVRFEQARTVEDVLARRTRALFMNARASIDMAPR
VAQIMAEELSLNRDWEVEQVAVYCDLAEGYCLEKKAM
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgagccaatatcattcaaagcatacatgacaccgcccagtgggatgtgttggtc
atcggcggcggcgcatctggcttgggcacggcgctagaggcagcttcgcgtggttatcgc
accttgttgctggaggcggaagattatgccaagggcaccagcagtcgcagcaccaaattg
gttcatggcggcgtgcggtatttggctcaaggcaacatcccgctggtgcgcgaagccttg
cacgagcgtggggtgttgaaaaataatgcaccgcatgtggtgcatgacatgggttttttg
atagcgtcttaccattggtggacaacacctttttatggcttgggtttgaaagtctatgac
ctgctggcggggcgactcaatgtgcgccgcagtcgttttgtgagtaaggctgaggctttg
caacacacgccgagtttgaagcagaagggtttaaagggcggcgtgttgtattttgatggt
caatttgatgacagccgtttggcgatcacgctcatgcgtacgctggttgatcagggtggg
gtggctttgaaccatgcgcccgtgacaggtttgttgaaggacaatgggcgtgtggtgggt
gcgacgtttcgagagacagaaacgggtgaaaaccaatctgtgcgggcaaccgtggtcatc
aatgcaacaggtgtttttgtggatgacattcgccgcatggaaaaccccgatgtcaaggcg
atgctgtcacccagtcaaggtgtgcatgtcgtggtggatcggcgttttttatcgggtgac
agtgcgttgatgattccaaaaacagaggatgggcgtgtgttgttcgctgtgccttggcat
gggcatgtgttgatcggcacgacggatacggccgtgccgcatgtcagcacagagccacgt
gctttgcccgaagaaattgaatttattttgcgcaccgcagcccaatatttggaacctgcg
ccgacgcgtgccgatgtgttgagtgtgtatgcgggtttgcgccctttggtgaaggccgag
gagggcacacagaccaaatccttgtcacgtgaccatgtgattcgagtgagtgagggcggt
atgatcacattgacgggtggcaaatggacgacctaccgtcgcatgggcatggacacggtg
gacaaagcggttgaactgcatggtcttgccgaacgcccaagtgtgactgagcaactgcgt
ttgcatggttgggcggatgatgcacctgccgaccattggcaagtctatggttcagatgcc
agatcgattcaggcattggatggcgcacaaacgctgctggatgcacgtttgccatatgtt
gaagcggaggtgcgctgggcggtgcgttttgagcaagcgcgaacagttgaggatgtcttg
gcgcggcgcacacgagcgttgtttatgaatgcccgagcgagcatcgatatggctccacgt
gtcgcgcagatcatggctgaggagttgtcgttgaaccgtgattgggaagttgagcaggtg
gcagtgtattgtgatttggctgaggggtattgtttggaaaagaaggcaatgtga

DBGET integrated database retrieval system