KEGG   Hymenobacter sedentarius: AUC43_03845Help
Entry
AUC43_03845       CDS       T04242                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
hyg  Hymenobacter sedentarius
Pathway
hyg00473  D-Alanine metabolism
hyg01100  Metabolic pathways
hyg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hyg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AUC43_03845
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    AUC43_03845
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hyg01011]
    AUC43_03845
Enzymes [BR:hyg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AUC43_03845
Peptidoglycan biosynthesis and degradation proteins [BR:hyg01011]
 Precursor biosynthesis
  Racemase
   AUC43_03845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C SIP
Motif
Other DBs
NCBI-ProteinID: ALW84305
UniProt: A0A0U4BVK5
LinkDB All DBs
Position
complement(910930..913494)
Genome map
AA seq 854 aa AA seqDB search
MFVFSALPALIAGHLLQSPADPAVEVRHLVLDSRRVGLPAGALFFALRGPSHNGHRYLPE
LYDQGVRLFVVEETAELPGSLSAYPGAGIIAVKSPLAALQALAAAHRAEFSGPVLAITGS
NGKTIVKEWLAQLLSPDEDICRSPRSYNSQVGVPLSAWELNPERHTLGIFEAGISEVGEM
ARLAAIIQPTEGIFTNLGTAHDAGFASSQHKLAEKLQLFQGPQFRRLFYCYDQPLVRAAV
AQRNIPGLSWTRHAGQPADLYFALDPNSTSGITSLHARYARVRLEAAFTLPFSDEPSIEN
ALHCLAVLLHRQVEPAEIQRRLARLHPVAMRLEMKLGRHDSYLLDDTYNNDLAGLALALN
ALSRQSRPGRRTLILSDVLESGLSGEELYARVAALLPPAGVTRLVGIGPEINRYRHFFTL
APPAGHPPLTADFYPDTEAFLASLDPNAFAREVILVKGARRFGFERIVAALQAQQHGTVL
EVNLDALSHNLQHYRRRLQPGTKLMVMVKAFAYGAGSYEVASLLEFQRADYLAVAYADEG
VALREAGISLPIMVMNPAPDSFSTLQHYRLEPEIFSFDMLNEYLAAFPAEAQPSAAQPLS
HSVAPPPIHLKLDTGMRRLGFDEADLPALAALLQQHPARLPVASLMTHLAAADEAEHDDF
TRTQLAAFRRMAAVLEAALGHAVLKHALNSAGILRFPEAHFDMVRLGIGLYGVDASGRDA
AALRPVSQLRTTISQIKTLPGGHTVGYGRRGAATEAERRIATLAIGYADGYDRRFGNGAG
TVLIHGQRAPLVGSVCMDMCMVDVTHIPQARAGDVALVFGEGLPLPELAARIGTIAYELL
TNVSERVKRVFVSE
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgtcttttctgctctcccggccctgatagccggccacctgctccagtcccccgcc
gaccccgccgtcgaggtgcgccacctggtgctcgacagccgccgggtggggttgcccgcc
ggggccttattttttgctctgcgcggccccagccacaatggccaccgctacttgcccgag
ctctacgaccagggggtgcggctgtttgtagtagaagaaacggccgaactgcccggcagc
ctcagcgcgtatcccggcgccggcattattgccgtgaaaagcccgctcgcagccttgcag
gctctggccgctgcccaccgcgccgaattcagtggccccgtgctagccatcaccggctcc
aacggcaagaccattgtgaaggagtggctggctcaactcctgagccccgacgaggacatc
tgccgctcgccacgctcctacaactcgcaggtgggcgtgccgctgagcgcgtgggaactg
aatcccgaacgccacacgctgggcattttcgaggccggcatttcggaagtaggggagatg
gcgcgcttggccgccatcattcagcccaccgaagggatttttaccaacctgggcacggcc
cacgatgccggctttgcctccagccagcataagttggccgagaagctgcagctattccag
ggcccccagtttcggcggctgttttactgctacgaccagccgctggtgcgcgctgccgtg
gcccaacgaaacatcccgggcttgagctggacgcgccacgccggacagcccgccgacctc
tacttcgcgctcgaccccaatagcaccagcggcatcaccagcctgcatgcccggtacgcc
cgcgtgaggctggaagccgcgtttacgctgcctttctccgacgagccgtctatcgaaaac
gccctgcactgcctggccgtgctgctgcaccggcaggttgagccggccgaaattcagcgc
cgcctcgcccggctgcaccccgtggccatgcgcctggagatgaagctggggcgccacgac
tcctacctgctcgacgacacctataacaacgacctcgccggcctggccctggccctgaac
gcgctgagccggcagtcgcgccccggtcgccgcaccctgattttgagcgacgtgctcgaa
tcgggcctgagcggagaggagctgtatgcccgtgtggcggccctgctgcccccggccggc
gtaacgcgcctcgtcggcattggccccgaaatcaatcggtaccgccacttctttaccctg
gcgccgcccgcaggccacccgccgctaaccgctgacttctaccccgataccgaagccttc
ctggcctcgctcgaccccaatgcctttgcccgcgaagttatcctggtaaagggcgcccgg
cgctttgggttcgagcgcattgtggccgccctgcaggcccagcagcacggcaccgtgctg
gaagtcaacctcgacgcgctcagccacaacctgcagcactaccgccgccggctgcagccc
ggcaccaagctcatggtgatggtgaaggcctttgcctacggcgctggctcctacgaagtg
gccagcctgctcgaatttcagcgggccgactacctcgccgtggcctacgccgacgaaggc
gtggccctgcgcgaagccggcatcagcctgcccattatggtgatgaacccggcaccggac
tcgttcagcacgctgcagcactaccgcctggagcccgaaatcttttccttcgacatgctg
aatgagtacctggccgctttcccggcggaagcgcagccctcagccgctcagccactcagc
cactccgtcgctcccccgcccatccacctcaagctggataccggcatgcgccgcctgggc
ttcgacgaagccgacctgcccgcgctggccgccttgctgcagcagcacccggcccgcctg
cccgtggccagcctcatgacccaccttgccgccgccgacgaagccgagcacgacgacttc
acccgcacgcagctggccgctttccggcgcatggccgccgtgctggaagccgcgctgggc
cacgccgtgctcaagcacgccctgaactcggccggcatcctgcgcttccccgaagcccac
ttcgacatggtgcgcctcggcatcggcctctacggcgtagatgccagcggccgcgacgcc
gcggccctgcgcccggtgagccagctgcgcaccaccatttcccaaatcaaaaccctgccc
ggcggccacaccgtgggctacggccgccggggcgcggccacggaggccgagcgccgcatt
gccacgctggccatcggctacgccgacggctacgaccgccgcttcggcaacggcgcgggc
acggtgctcatccacgggcagcgggcgccgctggtgggctcggtatgcatggatatgtgc
atggtcgacgtgacccacattccgcaggcccgcgccggcgacgtggccctggtctttggc
gaggggctgccgctgccggagttggccgcccgcatcggcaccattgcctacgagctgctc
accaacgtgagcgagcgggtgaagcgggtgtttgtgagcgagtaa

DBGET integrated database retrieval system