KEGG   Hymenobacter sedentarius: AUC43_05500Help
Entry
AUC43_05500       CDS       T04242                                 

Definition
(GenBank) galactose mutarotase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
hyg  Hymenobacter sedentarius
Pathway
hyg00010  Glycolysis / Gluconeogenesis
hyg01100  Metabolic pathways
hyg01110  Biosynthesis of secondary metabolites
hyg01120  Microbial metabolism in diverse environments
hyg01130  Biosynthesis of antibiotics
Module
hyg_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:hyg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AUC43_05500
   00052 Galactose metabolism
    AUC43_05500
Enzymes [BR:hyg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     AUC43_05500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim Antimicrobial15 DUF3558
Motif
Other DBs
NCBI-ProteinID: ALW84587
UniProt: A0A0U4BDD9
LinkDB All DBs
Position
1326550..1327752
Genome map
AA seq 400 aa AA seqDB search
MTHSFRAVRLAVPFSSLLLLAACGSNKSADQTSASSPAAADSTQTKSTAMPTSASFGKTN
DGTEVQLFTLTNASGAKATITNFGGTLTSLIVPDKNGKMGDVILGFDNVSGYQSPEFLKS
GPYFGALIGRYGNRIKGGKFALDGKTYTLATNNGPNTLHGGKVGFDKVVWKAEPGTSADG
QTLKLSYLSKDGEEGYPGNLNVAVVYTLTNDNALKIDYTATTDKATPINLTNHAYFNLNH
GAGKDILGHEVTIPADRYTVVDATLIPTGELRPVKGTPFDFTTPHAIGERIAQVPGGYDH
NWVLNNAATPQHAAATVYEPITGRTMEVTTDEPGIQFYTGNFLDGTLKGKGGTVYGKHAG
FCLETQHFPDSPNQPKFPSTVLKPGETFHSVSTYKFGVRK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacccattcctttcgtgccgtgcgtttggccgtacccttctccagcctgctgttgctg
gccgcctgcggctccaataaatccgccgaccaaacttcggcatcgtcgcccgccgctgcc
gattccacccaaacgaaatctaccgccatgcccacctccgcatcctttggcaaaaccaac
gatggcaccgaagtgcagctttttaccctcaccaacgccagcggggctaaggccaccatt
accaattttggcggcacgctcaccagcctcatcgtgcccgacaaaaacggcaagatgggc
gacgtcatcctcggcttcgacaacgtgagcggctaccagagccccgagttcctgaagtcc
ggcccgtacttcggcgctctgattgggcgctacggcaaccgcatcaaaggcggcaaattc
gccctcgacggcaagacttatactctggctacaaacaatggccctaacaccctgcacggc
ggcaaagtgggcttcgacaaggtggtgtggaaggccgagcctggcacctcggccgacggc
caaaccctgaaattgagctacctgagcaaggacggcgaagaaggctaccccggcaacctg
aacgtggcagtggtgtacaccctcaccaacgacaacgccctcaaaatcgactacacggcc
acaaccgataaggccacgcccatcaacctgaccaaccacgcctacttcaacctgaaccac
ggcgccggcaaggacattctgggtcacgaagtaaccatccccgccgaccgctacaccgtg
gttgacgccaccctgattccgaccggtgagctgcgccccgtgaagggcacgcccttcgac
ttcaccacgccccacgccatcggcgagcgcatcgcgcaggtgcccggcggctatgaccac
aactgggtgctgaacaacgccgccacgccgcaacacgcggccgccacggtgtatgagccc
atcaccggccgcacgatggaagtgaccaccgacgagcccggtatccagttctacaccggc
aacttcctcgacggtaccctcaagggcaaaggcggcaccgtgtacggcaagcacgccggc
ttctgcctcgaaacccagcacttccccgactcgcccaaccagcccaagttccccagcacg
gtgcttaagccgggcgagactttccactccgtgagcacctacaagtttggcgtccggaaa
tag

DBGET integrated database retrieval system