KEGG   Hymenobacter sedentarius: AUC43_10760Help
Entry
AUC43_10760       CDS       T04242                                 

Definition
(GenBank) fatty acid desaturase
  KO
K00508  linoleoyl-CoA desaturase [EC:1.14.19.3]
Organism
hyg  Hymenobacter sedentarius
Pathway
hyg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hyg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00591 Linoleic acid metabolism
    AUC43_10760
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hyg01004]
    AUC43_10760
Enzymes [BR:hyg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     AUC43_10760
Lipid biosynthesis proteins [BR:hyg01004]
 Desaturase
  Front-end
   AUC43_10760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase DarT
Motif
Other DBs
NCBI-ProteinID: ALW85528
UniProt: A0A0U4C5I6
LinkDB All DBs
Position
2620826..2621893
Genome map
AA seq 355 aa AA seqDB search
MSLPKFAATRSFHTELKTRINQYFEESGRPMTGDSGLLLKAILLVGTMVALYVHLVFFTP
AAAWALLECTLMGCVIAATGFNVMHDGAHGSFSRFPWLNKMAAYTLGVMGGSPYMWNSKH
NLIHHTYTNIEGHDDDIDVKPWMRMTPDQPKHSLHRYQHFYFWALYCMLYITWIFAMDYQ
KYFTRQIGAIGLKPMNAGEHISFWGFKALNLVLFVVLPIYMVGFLPWLAGFFLSMAVAGF
VLSMVFQLAHTVEDAAFPVPHPVTAKLEDEWAIHQVRTTANFATDNKVVSWLVGGLNFQI
EHHLFPKISHVHYPAISKIVQQVCSEFDVTYNNYRHTRSAIASHVGFLRQMGRAA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgtccttacccaaatttgccgctacacgctcctttcacaccgagcttaaaactcgcatt
aatcaatacttcgaggagtctggtcggccaatgacgggggattcgggcctcttattaaag
gcaatcttgttggtgggcaccatggtcgcgctttacgtgcacttggtgttttttacgccg
gctgccgcctgggccctgctcgagtgtaccctcatgggctgcgtcattgcggccacgggc
tttaacgtgatgcacgacggagcacacggcagcttttcccgctttccgtggctcaataaa
atggcggcctacaccctgggcgtgatgggcggcagcccctacatgtggaattccaagcac
aatctcatccaccacacctataccaacatcgagggccacgacgacgacatcgacgtgaag
ccttggatgcgcatgacccccgaccagcccaagcactcgctgcaccgctatcagcacttc
tatttctgggccctgtactgcatgctgtacatcacttggatttttgccatggactaccag
aagtacttcacccgtcaaatcggcgccataggcctcaagcccatgaacgccggtgagcac
atcagcttctggggcttcaaagccctcaatttggtgcttttcgtggtgctgcccatttac
atggtagggttcctgccctggttggccggcttctttctgagcatggccgtggccggcttt
gtgctcagcatggtgttccaattggcccacaccgtagaggatgccgcttttcccgtgcct
catccagttactgctaaactcgaagacgagtgggccatccaccaagtgcgcaccacggcc
aactttgctacggataataaggtggtaagctggttggtaggggggctcaacttccaaatt
gagcaccacttgttccccaagatttcgcacgtccattaccccgccatcagcaagattgtg
cagcaggtgtgcagcgagtttgacgtgacctacaacaactaccgccacacccgctcggcc
attgcctcgcacgtaggcttcctccgccagatgggccgcgccgcttag

DBGET integrated database retrieval system