KEGG   Hymenobacter sedentarius: AUC43_17480Help
Entry
AUC43_17480       CDS       T04242                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hyg  Hymenobacter sedentarius
Pathway
hyg00473  D-Alanine metabolism
hyg00550  Peptidoglycan biosynthesis
hyg01100  Metabolic pathways
hyg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hyg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AUC43_17480
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AUC43_17480
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AUC43_17480
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hyg01011]
    AUC43_17480
Enzymes [BR:hyg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AUC43_17480
Peptidoglycan biosynthesis and degradation proteins [BR:hyg01011]
 Precursor biosynthesis
  Amino acid ligase
   AUC43_17480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ALW86712
UniProt: A0A0U4C8U4
LinkDB All DBs
Position
4274994..4277708
Genome map
AA seq 904 aa AA seqDB search
MKIGIFFGGTSREREISFAGGRTVFDNLDKALFQPVPIFVDSLGQFILLDWQFIYKGTIR
DFYPPVESQPASVHHLQVYIESLGELSHEEWFHAIMKVGRQVQVEELPQLMDFAFLALHG
PGGEDGAIQGMLEWLGIPYSGSGILPSAFGIDKIAQKNLLHALNRPTPNFRVIKAEEWDT
TDHAATLAYLVRELGLPLVLKAPRQGSSIGVSILKTDNLAKFEAAIDRSLFRKLVTREDW
LRLGEQDKLAWVQHLTDIREGIGLPVVFDDETAPIYHPETLLFALNERLESAEQVLLTNV
DGETQVLVESFVAGREFSCIVVEDPNGLPLALPPTEIVKGEEMFDYRSKYLPGLARKVTP
IDLPEAKIQEIREACEEMFRTFGFQVYARLDGFVGHDGKLFLNDPNTTSGMLPASFFFHQ
AAEIGLNPSQFLTYLIRTSLAARRRAGLRPVKLAQLLAKLDEAVAGRQHEATERIRVAVI
MGGYSSERHISVESGRNIYEKLSSSAKYAPVPVFLTGSADEHKLYVLPVNVMLKDNADDI
REKIEHAEAGEAPHPILERIRREASVITSTYAGQALAQPRRISFEELAQLADEVFIALHG
RPGEDGALQQQLEKLHLPYNGSGVASSSVTINKFETNERLRKAGLLVADHRMAPKLEWQA
DAESFYRSLETQFAYPFIAKPADDGCSSAVKKIKNRLELEAFCQLIFRTEEDLLSGPAAV
LHLGFKEEFPRKDAFLVETLISRDGAAHFLEITGGLLTSYDEQGQLKIEVFEASEALATG
EVLSLEEKFLAGEGQNITPARYASDSAERQRISDEVKAVLRRVAEVLDIQGYARIDAFVR
VRQQGQVEVLIIEVNSLPGMTPATCIFHQTALAGYTPYQFIDRILEFGKARVERASHVPT
PLLS
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggcatttttttcgggggcacttcgcgcgagcgggaaatttctttcgccggc
ggccgcaccgtctttgataatctagataaggccctgttccaaccggtgcccatcttcgtg
gatagccttgggcagtttattctgctcgactggcagtttatttacaagggcaccatccgg
gacttttacccgcccgtggagtcgcagccggcctccgtgcaccacctgcaggtatacatc
gaaagcctgggcgaattgagccacgaggagtggtttcacgccattatgaaggtgggccgg
caggtgcaggtagaggagctgccgcagctcatggacttcgcgtttctggccctgcacggg
ccgggcggcgaagacggcgccattcaaggcatgctggagtggctgggcatcccctactcc
ggctccggcattctgccctcggccttcggcatcgacaagattgcgcagaaaaacctgctg
cacgccctgaaccggcccacgcccaatttccgcgtcatcaaggccgaggaatgggacacc
accgaccacgccgccacgctcgcctacctggtgcgcgagctgggcttgccgctggtactc
aaggcgccgcgccagggctcgagcatcggcgtgagcattctcaaaaccgacaacctcgcc
aagtttgaggccgctatcgaccgtagtttattccgcaaactcgtgacccgcgaagactgg
ctgcgcctcggcgagcaggacaagctggcttgggtgcagcaccttaccgacatccgcgag
ggcatcggcctgccggtggtgttcgacgacgaaaccgcgcccatctaccaccccgaaacc
ctgctcttcgccctcaacgagcggctggaaagcgccgagcaggtgctcctgaccaacgta
gacggcgaaacccaggtgctggtggaaagcttcgtggccggacgcgagttcagctgcatt
gtggtagaagaccccaacggcctgccgctggccctgccgcccacggagattgtgaagggc
gaggagatgttcgactaccgctcgaagtacctgcccggcctggcccggaaagtcacgccg
attgatttgccggaggcgaagattcaggaaatccgcgaggcctgcgaggagatgttccgc
acgttcggcttccaggtatatgcccgtctcgatggctttgtgggtcacgatggcaaactg
tttttgaatgacccgaacaccacttcgggcatgttgccggcgtcgttcttcttccaccag
gcagcggaaatcgggctgaatccttcacagtttctcacctacctcattcgtacgtcgctc
gcggcgcgccgccgcgccggcctgcgcccggtgaagctggcgcaactgctggccaagctg
gacgaagccgtagccggccgccagcacgaggccaccgagcgcattcgggtggccgtgata
atgggcggctactcgtcggagcgccacatttcggtggaaagcggccgcaacatctacgag
aagctcagctcctcggccaagtacgcgccggtgcccgtgttcctcaccggctcggccgac
gagcacaagctctacgtgctgcccgtgaacgtgatgctgaaggacaacgccgacgacatc
cgcgagaaaattgagcacgccgaagccggcgaggctccgcacccgattctcgaacgcatc
cgccgcgaggccagcgtcatcaccagcacctacgcgggccaggccctggcccagccgcgc
cgcatttctttcgaagagttagctcaactcgccgatgaggtgttcattgccctgcacggc
cggcccggcgaagacggcgccctgcagcagcagctcgagaagctccacctgccctacaat
ggctcgggcgtggccagcagcagcgtcaccatcaacaagttcgaaaccaacgagcgcctg
cgcaaagccggcctgctcgtggccgaccaccgcatggcccccaagctggagtggcaggcc
gacgccgaaagcttctaccgctcgctcgaaacccagttcgcctaccccttcatcgccaag
cccgccgacgacggctgctcttcggcggtaaagaaaatcaaaaaccggctggagctggag
gctttctgccagttgattttccgcaccgaagaggacttactctccggcccggccgcggtg
ctgcatctgggctttaaggaggagtttccgcgcaaggatgccttcctggtcgaaaccctc
atcagccgcgatggggccgcgcacttcctggaaatcacgggcggccttctcacgtcgtac
gacgagcagggtcagctcaagattgaggtgttcgaggccagcgaggccttggctaccggc
gaggtgctgagcctcgaggagaagttcctggccggtgagggccagaacattacccccgcc
cgctacgcctctgactccgccgagcgccagcgcatctccgacgaggtgaaggccgtgctg
cgccgcgtggccgaggtgctcgacatacaaggctacgcccgtatcgatgcgtttgtgcgc
gtgcgccagcagggccaggtagaggtgctcattatcgaagtcaactccctgcccggcatg
acgcccgccacctgcattttccaccaaaccgccctggccggctacacgccctaccagttt
atcgaccggattctggagtttggcaaggcccgggtggaacgagcaagtcatgtccccact
cccctccttagctaa

DBGET integrated database retrieval system