KEGG   Hymenobacter sedentarius: AUC43_19335Help
Entry
AUC43_19335       CDS       T04242                                 

Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
hyg  Hymenobacter sedentarius
Pathway
hyg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hyg01100  Metabolic pathways
hyg01110  Biosynthesis of secondary metabolites
hyg01130  Biosynthesis of antibiotics
hyg01230  Biosynthesis of amino acids
Module
hyg_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:hyg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AUC43_19335
Enzymes [BR:hyg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     AUC43_19335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH
Motif
Other DBs
NCBI-ProteinID: ALW87035
UniProt: A0A0U4BKD9
LinkDB All DBs
Position
complement(4748640..4749686)
Genome map
AA seq 348 aa AA seqDB search
MDSSVIIGPEALPALAEFLYRPAVSRVFVLVDSNTSRLCLPLLEKHLPANYHLIEIPAGE
EYKTLATCDTVWCQLTEQRADRHAVLVNLGGGVVTDLGGFAAALYKRGIRFVQVPTTLLA
QVDASVGGKTGIDFQGYKNQLGVFQAPAAVFIEPGFLQTLDPRQLKSGYAEVLKHWLIAD
AAAFNVHRRLGWLTDDWTPIIRESVALKQRIVAQDPLESGPRKLLNFGHTVGHALESYLL
SQPGREILHGEAVAAGLVCESWLSVQRGLLSAEELDKIETFVFSVFDKVAFVGLETDAIA
DLALQDKKNAGAIINCTLLNGIGNGVFDQPVTVAEIAESLRYYHRLQA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggatagttccgttattattgggcccgaagccctgcccgcgctggccgaatttctgtac
cggccggccgtgagccgggtgtttgtgctggtcgacagcaatacgtcacgcttgtgcttg
ccgctgctggaaaagcacttgccggccaattaccacctcatcgaaatcccggcgggggaa
gagtacaagaccctggccacctgcgataccgtgtggtgccagctcaccgagcagcgcgcc
gaccggcacgccgtgctggtgaacctgggcggcggcgtggtcacggacttgggcggcttt
gcggcggcgctttacaagcgcggcattcggtttgtacaggtgcctaccacgctcctggcg
caggtagacgccagcgtgggcggcaaaaccggcattgatttccagggctacaaaaaccag
ctgggcgtgtttcaggccccggccgccgtatttattgagccgggatttttgcaaaccctg
gacccgcgccagctcaaatcgggctacgccgaagtgctcaagcactggctcattgccgat
gcggccgccttcaacgtgcaccgccgcctgggctggctcaccgacgactggacaccgatt
atccgcgagtcggtggcgctcaagcagcgcatcgtggcgcaagacccactggagagcggc
ccgcgcaagctgctcaacttcggccataccgtgggccacgccctcgaaagctacctgctg
agccagcccggccgtgagattctgcacggcgaggccgtagccgccggcctggtgtgcgaa
agctggctgtcggtgcagcgcggcttgctgagcgccgaggagctggacaaaatcgaaacc
ttcgtgttttcggtattcgacaaggtggcgttcgtggggctggaaaccgacgccattgcc
gacctggcgctgcaggacaagaaaaacgcgggcgccatcatcaactgcaccttgctcaac
ggcatcggcaacggcgtatttgaccagcccgtgacggtagccgaaatcgccgaatcgctg
cgctattaccaccggctgcaagcgtag

DBGET integrated database retrieval system