KEGG   Hymenobacter sp. sh-6: D3Y59_05245Help
Entry
D3Y59_05245       CDS       T05656                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase/oxidase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hyh  Hymenobacter sp. sh-6
Pathway
hyh00564  Glycerophospholipid metabolism
hyh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hyh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    D3Y59_05245
Enzymes [BR:hyh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     D3Y59_05245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like Pyr_redox_2 GIDA NAD_binding_8 Pyr_redox_3 Lycopene_cycl 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AYA36513
UniProt: A0A3B7QZ81
LinkDB All DBs
Position
complement(1244486..1246081)
Genome map
AA seq 531 aa AA seqDB search
MKSVTTAFQRDAQLRLVAGGSHWDVVVIGGGATGLGVALDAVSRGFSVLLLEQADFAQGT
SSRSTKLVHGGVRYLAQGNLGLVREALRERGLLLRNAPHVAHSQTFVIPAYGRFARPYYA
LGLKLYDWLAGRLGLGSSRMLSAAQTRAYLGTNLRTAGLRGGVLYHDGQFDDARLALNLA
QTCAAHGAAVLNYAAVRSLLKAANGQVQGVEFEDRETGQRHRALGSVVVNATGVFVDEVL
RLDEPRQAPLVRPSQGVHLVLPRRFLPGSAALLIPRTSDGRVLFAVPWHGHVVLGTTDTP
LPQASPEPRALPEEVDFILTTAARYLQAAPTRADVLSVFAGLRPLAATSSGAGATKNISR
RHYLRVSASGLYTITGGKWTTFRQMGEVVLGRATALGKLPHRPSGSATLPIHGAPPVPHQ
SEAPGHLGVYGTDLPALQQLLADNPSWADPLDAAFAYLQGEVVWAARHEMARTVEDVLAR
RLRVLFLDARAAQRMAPRVAALLAQELGRPEAWQREQVASFTELAQGYLLP
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcagttaccaccgcctttcaacgcgatgcgcaattgcggctcgtggccggcgga
tcccattgggacgtggtggtgattgggggcggggccactggcctgggcgtggcgctcgat
gccgtgagccgcggcttttcggtgcttttgctcgagcaagccgatttcgctcaaggtacc
tccagccgtagcaccaagctggtgcacgggggcgtgcgctacctggcgcaaggcaaccta
gggctggtgcgcgaagccctgcgcgaacgaggtttgttgctgcgcaacgccccgcacgtg
gcgcatagccaaaccttcgttattccggcctacgggcgctttgcccggccgtactacgct
ctcggcctgaaactatacgactggctggccgggcgcctggggctgggcagttcgcggatg
ctttcggcggcgcaaacccgggcttacctagggaccaacctgcgcacggctggcttgcgc
ggcggtgtgctctaccacgacggccagttcgacgatgcccgcctggccctaaacctcgcg
caaacctgcgccgcgcacggcgccgccgtgctcaactacgccgcggtgcgcagcctgctg
aaagccgccaacgggcaagtgcaaggcgttgagttcgaagaccgcgaaaccggccagcgc
caccgcgcgctgggcagcgtggtcgtcaacgccaccggcgtgttcgtggatgaggtgctg
cgcctcgacgaaccccgccaagccccgctcgtgcgccccagccagggcgtgcacctcgtg
ctgccgcggcggtttctgccgggctcggcggcgctgctcatcccgcgcacttccgatggc
cgggtgctctttgccgtgccctggcacggccacgtggtactgggcaccaccgataccccg
ctgccccaagccagccccgaaccgagggccctgcccgaagaagtcgactttattttgacc
accgccgcccgctacctgcaggccgcgcccacccgcgccgatgtgctgagcgtgtttgcc
gggctgcggcccctcgcagcaacaagctccggcgccggcgctaccaaaaacatttcgcgg
cggcattacctgcgcgtttcggcgtcggggctgtataccattaccggcggcaaatggacg
accttccgccagatgggcgaagtcgtgctcggccgcgccactgctttaggcaagctgccc
caccgaccgagcggcagcgccacgctgcccatccacggcgcgccgccggttcctcatcag
tccgaagcccccgggcacctaggcgtttacggcaccgacttgcccgctttgcagcagcta
cttgccgacaacccatcctgggccgacccgctggatgctgccttcgcgtacttgcagggc
gaagtagtatgggccgcccgccacgaaatggcccgaaccgtggaggatgttctggcgcgc
cgcttgcgcgtgcttttcctcgatgcccgcgccgcccagcgcatggcaccgagggttgcg
gccttgcttgcgcaggagctaggtcgccccgaagcatggcagcgcgagcaggtagccagc
tttacggaattggcgcaaggctacctgttgccgtaa

DBGET integrated database retrieval system