KEGG   Hymenobacter sp. sh-6: D3Y59_07440Help
Entry
D3Y59_07440       CDS       T05656                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hyh  Hymenobacter sp. sh-6
Pathway
hyh00473  D-Alanine metabolism
hyh00550  Peptidoglycan biosynthesis
hyh01100  Metabolic pathways
hyh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hyh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    D3Y59_07440
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    D3Y59_07440
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    D3Y59_07440
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hyh01011]
    D3Y59_07440
Enzymes [BR:hyh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     D3Y59_07440
Peptidoglycan biosynthesis and degradation proteins [BR:hyh01011]
 Precursor biosynthesis
  Amino acid ligase
   D3Y59_07440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AYA36903
UniProt: A0A3B7R0C2
LinkDB All DBs
Position
1742769..1745540
Genome map
AA seq 923 aa AA seqDB search
MRIGIFFGGPSREREISFAGGRTVYDNLDKSLFQAVPVFVDSHGNFILLDWQYLYKGTIR
DFYPPVSALPPSDLKLQVYLESLGALSPDEQDRIIAEVGRRLRPDELAELMDFAFLALHG
PSGEDGAIQGLLEWYGIPYSGSGILPSAFGIDKIAQKTLIHALGLPSPAFRVLTAEEFDA
ADPAALLAYLERELGLPLVMKAPRQGSSIGVSIVRDADVAKFTAAVERSLFRRTVTREEW
QRLGAQDRIAWAQHLIDIREGIGLPVVIDESPVAGFQLSVNGQPNDLTTGNSQLAPGFIY
HPEELLRALDERLKLQDSVRLTNVQGEQQVLVEAFVQGREFSCIVVEDVDGTPLALPPTE
IVKGTEVFDYRSKYLPGMARKITPIELPEADIQRIREQCEQLFRTFGFQVYARLDGFITE
SGDIFLNDPNTTSGMLPASFFFHQAAEIGLNPSQFLTYIIRTSLAARRRGGLQPVKLGRK
LHALDQAVASRQHEQKPRTKVAVIMGGYSSERHISVESGRNIYEKLSSSAKYEPVPVFLT
GSSADYQLYVLPINVMLKDNADDIRDKVRHYEAGHGQHPILERIRQEASKITHTYAAQSV
AVPEKLTFEQLAERVDEVFIALHGRPGEDGALQQQLERVGLSYNGSGVESSSITINKFET
NRRLREAGLRVAEHRLAARLEWEANPEAFYRSLEEQFAYPFIAKPSDDGCSSAVKKIKNR
AELEAFARLIFRDQEDLHEDAARTLNLGFKEEFPRKEVFLVETLISRDGAKHFLEITGGL
LTHRRPDGGRDIEVFEASEALATGEVLSLEEKFLAGEGQNITPARYAADAAERQRVSEEV
KKELRRVAEVLNIEGYARIDAFVRVRENGEVEVLIIEVNSLPGMTPATCIFHQTALAGYT
PYDFIDRILEYGKGRSENSEVRS
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgagaattggcattttcttcggtggcccgtcgcgtgagcgggaaatttccttcgctggc
ggccgcacggtttacgataacctcgataagtcgctgttccaggccgtgccggtcttcgtg
gacagccacggcaacttcattctgctcgattggcagtacctttataaaggtaccatccgc
gacttctacccgcccgtgtcggccctgccgccctcggacctgaagctgcaggtatacctc
gagagcctaggtgcactgagccccgacgagcaagaccgcattattgcggaggtaggccgc
cgcctgcgccccgacgagctggccgagctaatggactttgcctttctggccctgcacggc
cccagcggcgaagacggcgccattcagggcttgctcgagtggtacggcattccgtactcg
ggctcgggcatattgccttccgcgttcggcatcgataagattgcgcagaaaaccctgatc
cacgccctaggtctgccttcgccggccttccgcgtgctcacggccgaggagttcgacgct
gccgaccccgccgccctgctggcttacttagagcgtgagctgggcttgccgctggtaatg
aaagcgccacgccaaggctcgagcattggtgtaagcattgtgcgcgatgccgatgtggcc
aagtttactgccgctgtggagcgcagcctgttccgccgcaccgtaacccgcgaggaatgg
cagcgcctaggtgcgcaggaccgcattgcctgggcacagcacctcattgatatccgcgaa
ggcattggcctgcccgtggtaattgatgagtcgccagttgccggtttccagttgtcagta
aacggccagccgaacgacctgacaactggcaactcgcaactcgcacctggcttcatttac
catcccgaagaactgctgcgcgcccttgatgagcgcctgaaactgcaagactcggtgcgc
ctcaccaacgtgcaaggcgagcagcaagtgctggtagaagcctttgtgcagggccgtgag
ttttcgtgcattgtggtagaagacgtggatggcacgccgctggccctaccccccaccgaa
atcgtaaagggcacggaagtattcgactaccgctcgaagtacctgcccggcatggcccgc
aagatcacgcccatcgagttgcccgaggccgacatccagcgcatccgcgagcagtgcgaa
cagctgttccgcacgttcggcttccaggtgtatgcccgcctcgacggtttcattaccgaa
agcggcgacatctttctgaacgacccgaacaccacctcgggcatgctgccggcatcgttc
ttcttccaccaggcagcggaaatcgggctgaacccctcgcagttccttacttacattatc
cgcacttcgctggccgcacgccgccgcggtggcctgcagcccgtaaagctgggccgcaag
ctgcacgccctcgaccaagccgtagccagccgccagcacgagcaaaagccccgcaccaaa
gtggccgtgattatgggcggctactcgtcggagcgccacatttcggtggaaagcggccgt
aacatttacgagaagctgtcgtcgtcggcgaagtacgagccggtgccggtgttcctcacg
ggctcgtcggctgattaccagctctacgtgctgcccatcaacgtaatgttgaaggacaac
gccgacgacattcgcgacaaggtgcgccactacgaggcgggccacggccagcaccccatt
ttggagcgcattcgtcaggaggcttccaaaatcacgcacacctacgccgcgcagtcggtg
gcggtgcccgaaaagctgacgtttgagcaactggccgagcgcgttgacgaggtattcatt
gccctgcacggccgccccggcgaagacggtgccctgcagcagcagctcgagcgcgtgggc
ttgtcctacaacggctcgggcgtggagtcgagcagcatcaccatcaacaagttcgaaacc
aaccgccgcctgcgcgaagccggcttgcgggtggccgaacaccgcctggccgcgcgcctg
gagtgggaagccaaccccgaagcgttctaccgctcgcttgaggagcagtttgcctacccc
ttcatcgccaagccttcggatgacggttgctcgtcggcggtgaagaaaattaagaaccgc
gccgagctcgaagcatttgcccgcctgatcttccgcgaccaggaagacctgcacgaagac
gctgcccgcaccctcaacctagggttcaaggaggagtttccgcgcaaggaagtgttcctg
gttgaaacgctcatctcgcgcgacggcgctaagcacttccttgaaattacgggtgggttg
ctcacgcaccgccgccccgatggtggccgcgacatcgaggtgtttgaagcctcagaagca
ctggcaaccggcgaagtactgagcttggaggagaaattcctggccggcgaaggacagaac
attaccccggcccgttacgcggccgacgccgccgagcgtcagcgcgtatcggaggaggtg
aagaaggagctgcgccgcgtggccgaggtactgaacatcgagggttatgctcgcatcgat
gcttttgtgcgggtgcgcgagaacggcgaggtggaggtgctcatcatcgaggtgaactcg
ctgccgggtatgacgccggccacttgcatcttccaccaaacggcgctggccggctacacg
ccctacgatttcatcgaccgcattttggagtacggcaagggtagaagtgagaactcagag
gtgagaagttag

DBGET integrated database retrieval system