KEGG   Hymenobacter sp. sh-6: D3Y59_14280Help
Entry
D3Y59_14280       CDS       T05656                                 

Gene name
kynU
Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
hyh  Hymenobacter sp. sh-6
Pathway
hyh00380  Tryptophan metabolism
hyh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hyh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    D3Y59_14280 (kynU)
Enzymes [BR:hyh01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     D3Y59_14280 (kynU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AYA38101
UniProt: A0A3B7RAP5
LinkDB All DBs
Position
3330749..3332035
Genome map
AA seq 428 aa AA seqDB search
MTFQNTHSFALQLDAADPLRAFRERFHIPAGPNGQPAIYCCGNSLGLLPKNARAAVEQEF
RSWEERAVEGHFHGTSPWMHYHETLTDATARVVGAKPLEVVVMNNLTTNLHLLLISFYRP
AGKRYKVLMEGGAFPSDQYALESQVKLHGYAPDDAIVELVPRPGEHTLRTQDIEARIAEL
GEELALVLLGGVNYYTGQAFDMAAITRAGHAAGAVVGFDLAHAAGNLVLHLHDWDVDFAC
WCTYKYLNSGPGGTSGVFVHERFAHQPDLPRLAGWWGHDPADRFQMKKGFRPMPGAAGWQ
LSNGQIFPMAIHRAALAVVEEAGGMPALRSKSEQLTGYLAFVLREAGLPANELEIITPEN
PAERGCQLSVLVHREGRALFDYLAAQGIVADWREPNVIRLAPVPLYNSFEEVWRIGQAFA
QWANRSAR
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgacgtttcagaacacccatagtttcgccctccaactcgatgcggccgacccgctccgc
gcgtttcgggagcggtttcacattcctgccgggcccaacggccagccggctatttactgc
tgcggcaactcgctggggctgctgcccaaaaacgcccgcgcggccgtggagcaggagttc
cggagctgggaggagcgcgctgtagagggccactttcatggcacctcgccctggatgcac
taccacgaaaccctcaccgacgccaccgcgcgggtagttggggccaaacccctggaagtg
gtggtgatgaacaacctcaccaccaacctgcacctgctgctgatctcgttttaccgcccc
gccggcaagcgctacaaagtgctgatggagggcggcgcgtttccttcggatcagtacgcc
ctggaaagccaggtgaagctgcacggctacgcccccgacgacgccattgtagagctggtg
ccccgcccgggcgagcataccctgcgcacccaggacattgaagcgcgcatcgcggagttg
ggcgaagagctggccttggtgctcctaggtggcgtaaactactacaccggccaggccttc
gacatggccgccattacgcgcgccggccacgccgccggggccgtggtagggttcgacctg
gcccacgcggccggtaacctggtgctgcacctgcacgattgggacgttgactttgcttgc
tggtgcacctacaagtacctgaattcgggcccgggcggcacttccggcgtattcgtgcac
gagcggtttgcccaccaacccgatttgccgcgcctggccggctggtggggccacgacccc
gccgaccgtttccagatgaaaaaaggcttccggccgatgcccggggcagcgggttggcag
ctttccaacgggcaaatattcccgatggccattcatcgcgccgcgctggcggtggttgag
gaagccggcggcatgccggcgctgcgtagcaaaagcgagcagctgacgggctacctcgcg
tttgtgctgcgcgaagccggcctgccggccaacgagctggaaatcattacgcccgaaaat
ccggccgagcgcggctgccagctttcggtgctggtgcaccgcgagggccgcgctttgttc
gactacctggccgcgcaaggcattgtggccgattggcgcgagccgaacgttatccggctg
gcgcccgtgccgctctacaactcgttcgaggaggtgtggcgcattgggcaagcgtttgcg
cagtgggccaaccgatcggcgcgctaa

DBGET integrated database retrieval system