KEGG   Hymenobacter sp. sh-6: D3Y59_15095Help
Entry
D3Y59_15095       CDS       T05656                                 

Definition
(GenBank) bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
hyh  Hymenobacter sp. sh-6
Pathway
hyh00473  D-Alanine metabolism
hyh01100  Metabolic pathways
hyh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hyh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    D3Y59_15095
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    D3Y59_15095
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hyh01011]
    D3Y59_15095
Enzymes [BR:hyh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     D3Y59_15095
Peptidoglycan biosynthesis and degradation proteins [BR:hyh01011]
 Precursor biosynthesis
  Racemase
   D3Y59_15095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AYA38249
UniProt: A0A3B7RC65
LinkDB All DBs
Position
3512170..3514671
Genome map
AA seq 833 aa AA seqDB search
MLTFSHLPALTGGTLLQAPADAAAPVLHLLLDSRRMAQAAGTLFVALRGPHHDGHQYVPE
LYQRGVRLFLIDKAEIVPGALANYPEAGFVLVPDSLVALQRIAAEHRARFDIPVVGITGS
NGKTIVKEWLAQLLSPDELICRSPRSYNSQVGVPLSVWELRPAHTLGIFEAGISERGEMA
RLARVVQPTLGIFTNLGSAHDAGFNSHAEKAAEKMQLFAGVDTLFYCRDHTEVHAAAEQL
PARVQRFSWSRRSATDAQVQVQLGPGADPQQPLAQVQYLGQTHTFTLPFADEPSVENALH
CVALLLWRGLPAAELQRRLLRLQPVAMRLEMKQAIHDCYILDDTYNNDLAGLDLALDALR
RQPRRGRRTLILSDLLESGLPAAELYQQVAQLARQHNVQRLLAVGSEISQHQGLLQAAVA
DAQFFADTDALLNWFHPDHFRHETILVKGARRFGFEQVVAAFQRKIHGTVLEVNLDALVH
NLNYYRARLQPNTRLMVMVKAFAYGSGSYEVANLLEFHRVDYLAVAYTDEGVQLREHGIS
LPIMVMNPSPDSFALLRQYHLEPEIYSFARLREYLMAAQSGPLPPIHLKLDTGMRRLGFD
EADLDELLPLLQQHAGTLRVASALTHLAGADEEQHNSFSHRQLAAFQRMAARLEAALGHA
VIKHALNSPGIMRFPEAQLDMVRLGIGLYGVEAAGLDPAALRAVSTLRTTVSQLKTLPAG
ETVGYGRRGEAADHNRRIATLAIGYADGYDRRFSRGVGAVIIRGQRAPIIGNVCMDMCMV
DVTEVPDVQEGDTAVVFGDELPLNELAARIGTIPYELLTNVSERVKRVFISEQ
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccttctcacatctgccggctcttacgggtggcacgctgctgcaggcacctgcc
gatgctgctgctccggtgcttcatttgctgctcgatagccgccgtatggcccaggctgcc
ggcaccttgtttgtggcactgcgcggcccccaccacgacgggcaccagtacgtgcccgag
ctgtaccagcgcggcgtgcgcctgttcctcatcgacaaggccgagatagtgcccggagcg
ctggccaactaccccgaagcgggctttgtgctggtgcccgatagcttagttgccttgcag
cgcattgccgccgaacaccgggccaggtttgatataccggtggtgggcattacgggctcg
aacggcaaaaccatcgtaaaggagtggctggcgcaactgctcagccccgacgagctcatt
tgccgctcgccgcgcagctacaactcccaagtaggtgtgccactgagcgtgtgggagctg
cgaccggcgcatacgctgggtatcttcgaagcgggtatttcggagcgcggcgaaatggcg
cgtttagcgcgggtcgttcagcccaccctaggtattttcactaaccttggctcggcacac
gacgccgggtttaactcgcacgccgagaaagccgccgagaaaatgcagctttttgccggc
gttgataccttgttttactgccgcgaccacaccgaggtgcacgcagcagccgaacagctg
ccggcgcgcgtgcaacgctttagctggtcgcgccgcagtgcaaccgatgcccaagtgcag
gtgcagctggggcctggtgccgacccccagcagccactggcgcaggtgcaatacctaggg
caaacgcacacgtttacgctgccttttgccgatgagccttcggttgaaaacgcgctccac
tgcgtagccttgctgctctggcgcgggttgcccgccgccgagctgcagcgccgcctgctg
cgcctgcaacccgtggccatgcgcctcgaaatgaagcaggccattcacgactgctacatt
ctcgacgacacctacaacaacgacctggccggcctcgatttagctttggatgcgctgcgc
cgccaaccgcgccgtggccgccgcacgcttatcctgtccgatttgctcgaatcgggcttg
cccgccgcggagctgtatcagcaggtggcccaacttgcccgccaacacaacgtgcagcgt
ttgctggctgtgggctctgaaatcagccagcaccaaggcttgctgcaggcggcggtagcc
gatgcgcaatttttcgccgacaccgatgcgctgctcaactggtttcaccccgaccacttc
cgccacgaaactatcctggtgaagggcgcccggcgttttggcttcgagcaggtagtagcg
gcttttcagcgcaaaattcacggcaccgtactcgaggtaaacctcgatgcattggtgcac
aaccttaactactaccgcgcccggctgcagcccaacacccgcctgatggtgatggtgaag
gcttttgcctacggcagtggctcctacgaagtagccaacctgctcgagtttcaccgcgtc
gactacctagccgtggcctacaccgacgaaggcgtgcagctgcgcgagcacggcatttcg
ttgccaatcatggtgatgaacccttcgcccgattccttcgccctgctaaggcaataccac
ctcgagcccgaaatctattcgtttgcccgcctgcgcgagtacctgatggccgcccaaagc
ggcccgctgccgcccatccacctcaagctcgacactggcatgcggcgcttaggcttcgac
gaagccgacctcgacgaattgttgcccttgctgcagcagcatgccggtacgctgcgcgta
gccagcgccctcacgcacctagccggcgccgacgaggagcagcacaacagcttctcgcac
cggcagctagcggctttccagcgcatggctgctcgcctcgaagcagccctaggtcacgcc
gtgatcaagcacgccctgaactccccgggcatcatgcgctttccggaagctcagctcgat
atggtgcgcctgggcatcggcttgtacggcgtcgaagctgctggcctcgatccggccgca
ctccgtgcggtgagcaccttgcgcaccaccgtttcgcagctgaaaaccttgccggctggc
gaaaccgtgggctacggccgccgcggcgaagccgccgaccacaaccgccgcattgccacg
ctggccattggctacgccgatgggtacgaccggcgtttttcgcgcggtgtgggggcggta
atcatccggggccagcgcgcacccatcatcggcaacgtgtgcatggatatgtgcatggtc
gacgtgacggaggtgcccgacgtgcaagaaggcgacacggccgtagtgttcggcgacgag
ttgcccctaaacgagctagctgctcgcatcggcaccatcccgtacgagctgctcaccaac
gtaagcgagcgggttaagcgggtgtttatatcggaacagtag

DBGET integrated database retrieval system