KEGG   Hydrogenophaga sp. LPB0072: LPB072_01455Help
Entry
LPB072_01455      CDS       T04505                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
hyl  Hydrogenophaga sp. LPB0072
Pathway
hyl00550  Peptidoglycan biosynthesis
hyl01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:hyl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LPB072_01455
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    LPB072_01455
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hyl01011]
    LPB072_01455
Enzymes [BR:hyl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     LPB072_01455
Peptidoglycan biosynthesis and degradation proteins [BR:hyl01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   LPB072_01455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AOW11719
UniProt: A0A167GS55
LinkDB All DBs
Position
complement(296037..298025)
Genome map
AA seq 662 aa AA seqDB search
MTELRNVDADIALFRTRVLVIGLTVFVAFGLLVSRMVYLQVVRHEDLQAQAESNRTAVLP
VVPNRGQILDRFGRVLATNFSAYTLEITPSEVDDLDATIEELALLLDITPRDKRRFSKLV
SESRRFDSLPIRSRLTDEEVARFTVQRYRFPGVDVRARLIRHYPNGEVASHVIGYIGRIN
QREKEQIEDWPDEDQANYRGTDHIGKLGAEQHYERELHGQTGFERVETSAGGQAVRLLAN
TPAVPGNTVRLAIDIKLQKLIEDMFGERRGALVAIDPRNGEVLAFVSKPTFDPNLFVEGI
DEENWKLLNESLDKPLLNRALRGTYPPGSTYKPFMAMAALETGARSASTVINDPGYWMFG
NHRFRSHGDGGLGAVDMRRSIIKSSNVYYYSLANEMGVDAMHDFMAPLGFGQITGIDLRG
EVRGVLPNQEWKRNAYKRPEQQRWYAGETISLGIGQGYNNFTMLQVAHAMATLANGGIKH
QPHLMLATEDTVTHERNPMPVSEAVNLGFKRANIDVVLRAMQGVTTEGTSARVFAGAEYE
SGGKTGTAQAVGIGQKDRYDARKLEEHQRDHSLYLAFAPVDKPRIALAVVVENAGFGSAN
AAPIARRVFDYLLLDQYPNAQDLKAVQRGEASSPSGTPLKASEVPWPIDPDAPKTAVEKP
SP
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcttcgcaacgtcgacgccgatatcgcgctgtttcgcacacgcgtactggtc
attggcctgaccgtttttgtcgcctttggccttttggtttcaaggatggtgtacctgcag
gtggtgcgccatgaagacctgcaagcccaggctgaaagcaaccgaacggcagtgctgccc
gtggtgcccaaccggggccagattcttgaccgctttggccgcgtgctggcgaccaatttt
tccgcctacaccctggaaatcaccccgtccgaggttgacgacctcgatgccaccattgaa
gagctggcgctgcttctcgacatcacaccgcgtgacaagcggcgcttcagcaagctcgtt
tcagaatcgcgccgcttcgactcattgcccatccgttcgcgcctgaccgacgaagaggtg
gcgcgcttcacggttcagcgctaccgctttcccggcgtcgatgtgcgcgcacgcttgata
cgccactacccgaatggcgaggtggccagccatgtcatcggctacatcggccgcatcaat
cagcgcgaaaaagagcagattgaagactggcccgatgaagaccaggccaactaccgcggc
accgaccacatcggcaagctgggcgccgaacagcactacgaacgagagctgcacggacag
accggcttcgaacgcgtcgagacctcggcgggtggccaggccgtgcgcctgcttgccaac
acgccagcggttcctggcaacaccgtcaggctggcgatcgacatcaagctgcagaagctc
atcgaagacatgtttggcgagcggcgcggtgcccttgtggccatcgacccgcgcaacggt
gaggttctggcgtttgtcagcaagcccacatttgaccccaacctgtttgtcgaaggcatc
gacgaagagaactggaagctgctgaacgaatcactcgacaaacccttgctcaaccgcgcc
ttgcgcggcacctacccaccgggctccacctacaagccgttcatggccatggcggcgctg
gagaccggcgcccgcagcgcgagcacggtgatcaacgacccgggctactggatgtttggc
aaccaccgtttccgcagccacggtgacgggggtctcggtgcagtggacatgcgccgcagc
atcatcaagtcgagcaacgtgtactactactccctcgccaacgagatgggcgtggacgcc
atgcacgacttcatggcccctctgggttttggccagatcaccggcatcgacctgcgcggc
gaagtgcgcggtgtcctgcccaatcaggaatggaagcgcaacgcctacaaacgtcccgaa
cagcagcgctggtacgcgggcgagaccatttcgctgggcatcggccagggctacaacaac
ttcaccatgctgcaagtggcccatgccatggccacgctggccaacggcggtatcaagcac
cagccccatctcatgctggccaccgaagacaccgtgacgcacgagcgcaacccgatgccc
gttagcgaagccgtcaaccttggattcaaacgcgccaacatcgacgtggtgttgcgcgcc
atgcaaggtgtgaccacagagggcaccagcgcccgcgttttcgcaggcgccgagtatgaa
agtggcggcaaaaccggcaccgctcaggcggtgggcatcggacagaaagaccgctatgac
gcacgcaagctcgaagaacaccagcgcgatcactcgctctacctggcctttgcgccggta
gacaaaccgcgcatcgcactggcggtggtggttgaaaacgcaggttttggctctgccaac
gccgcgcccatcgcccgccgtgtctttgattacctgttgctcgatcaataccccaacgcc
caggatctcaaggccgtacagagaggtgaggcctcttccccttcgggtacaccactcaag
gccagcgaagtcccctggcccatcgatcccgatgcgccaaagaccgcagtcgaaaagcca
tcaccttga

DBGET integrated database retrieval system