KEGG   Hydrogenophaga sp. LPB0072: LPB072_01485Help
Entry
LPB072_01485      CDS       T04505                                 

Gene name
gatB
Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
hyl  Hydrogenophaga sp. LPB0072
Pathway
hyl00970  Aminoacyl-tRNA biosynthesis
hyl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hyl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LPB072_01485 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hyl03029]
    LPB072_01485 (gatB)
Enzymes [BR:hyl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     LPB072_01485 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     LPB072_01485 (gatB)
Mitochondrial biogenesis [BR:hyl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    LPB072_01485 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey Phage_TAC_11
Motif
Other DBs
NCBI-ProteinID: AOW11725
UniProt: A0A162YSB2
LinkDB All DBs
Position
302652..304106
Genome map
AA seq 484 aa AA seqDB search
MSSPKSLLVQGYEVVIGFETHAQLATQSKIFSRASTAFGAEPNTQACAVDMALPGTLPVM
NREAVAHAIRLGLALGSHIAEESVFARKNYFYPDLPKGYQISQFEIPVVQGGEVSFLLGE
EKKTVRLVRAHLEEDAGKSLHEDFIGQSGIDLNRAGTPLLEIVTEPDMRSTAEAVAYAKE
LHKIVTWIGVCDGNMQEGSFRCDANVSVRKPGAPLGTRREIKNLNSFKFMQQAMDYEIRW
QIEQIEDGFEIQQATVLFDPDTGETRAMRTKEDAADYRYFPDPDLPPLVVSREWVEQVRT
EMPELPRQMAQRFVDTYGLPEYDASTLTQSPAMAAYFETAAKASGQAKMASNWVMGEVSR
RLNAEEKGVEQAPVGADLLAALLKRIADGTVSNNAAKQVMEALWSGDGADVDAVIEAKGL
KQMNDSGAVVKIIDDVLAANAEMVEQFKAGKEKAFNALVGLCMKASKGKANPQQVNDLLR
EKLN
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagttcccccaagtcgctgttggtgcagggctacgaggtcgtgatcggtttcgaaacc
cacgcccagcttgccacccaatccaaaattttcagccgcgcgtcgaccgcgtttggcgcc
gaacccaatacccaggcatgcgcggtggacatggccttgccaggcactttgccggtgatg
aaccgcgaggccgtggcccatgcgatccgtctgggtctggcgctgggttcgcacatcgct
gaagagagcgtgtttgcacgcaaaaactacttctatcccgacctgcccaagggttaccag
atcagccagttcgagatcccggtggtgcagggtggcgaagtgtcgttcctgctcggcgag
gagaagaagacggtacgcctggtgcgcgcgcacctggaagaagacgctggcaaatcgctg
cacgaagactttatcgggcagtccggcattgacctcaaccgcgctggcacaccactgctg
gaaatcgtgaccgagcccgacatgcgctcgaccgccgaagcggtggcctatgccaaggag
ctgcacaagatcgtgacctggatcggggtgtgcgatggcaacatgcaggaaggcagcttc
cgctgcgatgccaacgtgtcggtgcgcaagcccggggctcctttgggtacacggcgcgag
atcaagaacctgaactcgttcaagttcatgcagcaagccatggactacgagatccggtgg
cagatcgagcagattgaagacggtttcgagatccagcaagccactgtgctgttcgatccg
gacacgggcgaaacccgcgccatgcgcaccaaggaagacgcggccgattaccgctacttc
cctgatccggacttgccgccgctggtggtctcgcgcgaatgggtggagcaggtgcgcacg
gagatgcccgagctgccacgccagatggcgcagcggttcgtggacacctatggcctgccc
gagtacgacgccagcacgctcacgcaaagccctgcgatggcggcgtattttgaaacggcg
gccaaggccagcggccaggccaagatggccagcaactgggtcatgggggaagtctcacgg
cgattgaatgccgaggaaaagggtgttgagcaagcgcctgtgggggccgacctgttggcc
gcattgctcaagcgcatcgcagatggaaccgtgtccaacaatgccgccaaacaagtgatg
gaggcgttgtggtcgggcgatggcgctgacgtggatgcggtcatcgaggccaagggtctc
aagcagatgaacgacagcggcgcggtcgtgaaaatcatcgacgatgtgctggcggccaac
gccgagatggtggagcagttcaaggcgggcaaagagaaggccttcaacgccttggtgggt
ctgtgcatgaaggccagcaaaggcaaggcgaatccgcagcaggtgaacgatctgctgcgt
gaaaagctgaattga

DBGET integrated database retrieval system