KEGG   Hydrogenophaga sp. LPB0072: LPB072_03760Help
Entry
LPB072_03760      CDS       T04505                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hyl  Hydrogenophaga sp. LPB0072
Pathway
hyl00564  Glycerophospholipid metabolism
hyl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hyl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    LPB072_03760
Enzymes [BR:hyl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     LPB072_03760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored NAD_binding_8 FAD_binding_2 HI0933_like Pyr_redox_2 FAD_binding_3 Thi4 3HCDH_N Pyr_redox_3 GIDA Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AOW12097
UniProt: A0A162VWP7
LinkDB All DBs
Position
785190..786770
Genome map
AA seq 526 aa AA seqDB search
MSRAAHFQSLNTDQTYDLAVIGGGATGLGVALDAALRGFSVVLLESHDFAGGTSSRATKL
LHGGVRYLAQGNVALVREALAERSTVLRNAPHLAQPLPFVMPSYQWWQSPFYGLGLKLYD
LMAGKAGLGRTEFLNAQQTLAALPGLKAAGLKGGVKYWDGQFDDARLALALARTAKVAGA
TVLNYAEVTALRMGIRKDGRSDPSEIDIIDRLSGDTATVSANCVVNATGVWVDALRNKAM
AGVPGAVPSQMVSPSQGVHVVVDRDFMPGNHALLMPKTRDGRVLFAVPWMGKLILGTTDT
PRKDIPREPGAFAEELEFILSEAAHVLSRPVTRADIRSIWVGLRPLVAPPRTEEGGTKTI
SREHTIVVDPNGLLTVTGGKWTTYRAMAEDVLNKCFDKGLLSTRPSANTKNHRLLGAPGK
NAPPSPIFAGPGVHLYGTEMAAVETCPGHENVLGMGLTEAMVRYAVREEYAYTVEDVLAR
RWRVLFLDAKVASSMGAAVAAIMQSEGVDNPRLTEFLKLCEHYLPG
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgcgcagcccatttccaatccctgaataccgaccaaacctacgacctcgctgtg
atcggcgggggggcaacagggttgggcgtggcattggatgcggcgctgcgagggttttct
gtggtcctgctcgaatctcacgatttcgctggcggcacctcttccagagcgaccaagttg
ctgcacggcggcgtgcggtatctggctcaaggcaacgtggcgctggtgcgtgaagccctg
gcagagcgatcgacggtgctgcgaaacgcaccgcacctggcgcagccactgccctttgtg
atgccctcttaccaatggtggcagagccctttctatggtctggggctcaagctctacgac
ctgatggcggggaaagcgggattgggtcgaaccgagtttctgaatgcgcaacagacactg
gccgcgttgcccgggctcaaggctgcgggactcaagggcggcgtgaagtactgggacggc
cagttcgacgatgcgcggctggcactggccttggctcgcacggcgaaagtggcgggtgcc
acagtattgaactacgcagaagtcaccgccttgcgcatgggcatccgtaaagatggcaga
agcgacccttctgaaattgatatcattgaccgtctaagtggcgatacagcaacagtgagc
gctaactgtgtggtgaatgcgaccggggtatgggttgacgcgctgcgcaacaaggccatg
gccggcgtaccgggcgcagtcccgtcgcagatggtcagcccgagtcagggcgtgcatgtg
gtggtcgaccgggacttcatgccagggaatcatgctttgctgatgcccaagacccgtgac
gggcgtgtgctgttcgccgtgccctggatgggcaagctcattctgggtaccaccgataca
ccgcgcaaagacattccccgagagcccggtgcattcgctgaagagctcgaattcatcttg
agcgaagccgcccatgtcttgagccgcccggtgactcgagccgacatacgcagcatctgg
gtcggattgcgccccctggttgcaccacccagaacggaagaggggggtaccaaaaccatc
tccagagaacacaccatcgtggtcgaccccaacggcttgctcaccgtcacggggggcaaa
tggacgacctaccgtgcgatggccgaagatgtattgaacaagtgcttcgacaagggactg
ctgtcgacccgaccgagtgccaacacgaaaaaccaccggttgttgggcgcgccaggcaaa
aacgcaccgccttccccgatttttgcagggccaggcgtgcacttgtacggaacagaaatg
gccgcagtcgaaacctgtccaggccatgagaacgttttgggcatggggctgaccgaggcc
atggtgcgctatgcggtccgggaggagtacgcctacacagtagaagatgtgttagccagg
cgatggcgcgtgttgtttctcgacgccaaggtagcctcatccatgggcgccgcagtagcg
gccatcatgcaaagcgaaggcgttgacaaccctcggctgaccgaatttctgaagctctgt
gagcactacctgcccggctag

DBGET integrated database retrieval system