KEGG   Hydrogenophaga sp. LPB0072: LPB072_18320Help
Entry
LPB072_18320      CDS       T04505                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
hyl  Hydrogenophaga sp. LPB0072
Pathway
hyl00630  Glyoxylate and dicarboxylate metabolism
hyl01100  Metabolic pathways
hyl01120  Microbial metabolism in diverse environments
hyl01200  Carbon metabolism
Module
hyl_M00165  Reductive pentose phosphate cycle (Calvin cycle)
hyl_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:hyl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    LPB072_18320
Enzymes [BR:hyl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     LPB072_18320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AOW14500
UniProt: A0A167IR76
LinkDB All DBs
Position
complement(3967722..3968069)
Genome map
AA seq 115 aa AA seqDB search
MQDYTSRLSDPASRKFETFSYLPPMTDAEIRKQVEYLVKKGWNPAIEHTEPRYLGDSYWY
MWKLPMFGETDVDKVLAEAEACRKANPDNHVRLIGYNNFNQSQGTSMVIFRGRTI
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgcaagactacacatcccgcctgtccgaccctgcgagccgcaagttcgagaccttctct
tacctgccacccatgaccgatgcggagatccgcaagcaggtcgagtacctggtcaagaag
ggctggaaccccgccattgaacacaccgagccacgctacctcggcgactcctactggtac
atgtggaagctgcccatgttcggggaaaccgatgtggacaaggtactggctgaagccgaa
gcttgccgcaaggccaacccggacaaccatgtgcgcctgattggctacaacaacttcaac
cagtcgcaaggcacctccatggtgatctttcgcggccggacgatctag

DBGET integrated database retrieval system