KEGG   Hydrogenophaga sp. LPB0072: LPB072_19315Help
Entry
LPB072_19315      CDS       T04505                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hyl  Hydrogenophaga sp. LPB0072
Pathway
hyl00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:hyl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LPB072_19315
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hyl02000]
    LPB072_19315
Enzymes [BR:hyl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     LPB072_19315
Transporters [BR:hyl02000]
 Other Transporters
  Pores ion channels [TC:1]
   LPB072_19315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_C_2 GST_N_2 GST_N GST_N_4 Tom37 GST_C
Motif
Other DBs
NCBI-ProteinID: AOW14655
UniProt: A0A163CKX1
LinkDB All DBs
Position
4173166..4173837
Genome map
AA seq 223 aa AA seqDB search
MLKLCGFSASNYYNKVKLALLEKGVAFEEELAWVGQTDPSASPLGKVPYFKTDAGPISES
TVMLEYIEAQYPSNALLPADPFQAAKARELVRYIELHLELVARNLYPEAFFGGKVSDSAK
EKVGQQLEKNVAAFAKLARFSPFVGGDSFTLADCAAAVHLPLISGATKLIYGRDFLADLP
VRDYLKLVGARPTVLQVNEDRKSNTEVMMQRAKAAAAAAKAQA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaactctgcggcttttctgccagtaactattacaacaaggtcaaactcgccctg
ctcgaaaagggtgtggcttttgaagaagagctggcctgggttggccagacggatccctcg
gccagcccgctgggcaaagtaccgtatttcaagaccgatgccggccccatcagcgaatcg
accgtgatgctggaatacatcgaggcgcaatacccgtcgaacgcgttacttccggccgac
ccgtttcaggcggccaaagcccgtgaactggtccgctacatcgaactgcacctggaactg
gttgcccgaaacctgtatccggaagccttctttggtggcaaggtcagcgattcggcgaaa
gagaaagtgggtcagcaactggaaaaaaacgtggccgcgttcgccaagctggcgcgcttt
tcaccttttgttggcggcgacagcttcaccctcgccgactgcgcagcggccgtgcatttg
cctttgatctccggcgccaccaaactcatttacggccgagattttctggccgacctgccc
gttcgcgactatctcaagctcgtgggtgctcgccccacggtgttgcaggtcaatgaagac
cgcaagtccaacaccgaagtcatgatgcagcgcgccaaggccgcagcagctgcagccaag
gcccaagcctag

DBGET integrated database retrieval system