KEGG   Hydrogenophaga sp. LPB0072: LPB072_21255Help
Entry
LPB072_21255      CDS       T04505                                 

Definition
(GenBank) ribonuclease II
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
hyl  Hydrogenophaga sp. LPB0072
Brite
KEGG Orthology (KO) [BR:hyl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hyl03016]
    LPB072_21255
Enzymes [BR:hyl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     LPB072_21255
Transfer RNA biogenesis [BR:hyl03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    LPB072_21255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB RNase_II_C_S1 S1 Phage_lysozyme
Motif
Other DBs
NCBI-ProteinID: AOW14970
UniProt: A0A162SXJ3
LinkDB All DBs
Position
complement(4589234..4590706)
Genome map
AA seq 490 aa AA seqDB search
MNHALINHRTNLSTLAAWAMFSRGLEPEFPVAALEQLASFKGAATGSGGGIRDLTDRDWC
SIDNDDSRDLDQLSLSEPMPRGGLRVFVAVADVDALVKKGTPIDQHAQLNTTSVYTSARI
FPMLPERLSTDLTSLNQGEDRLAIVSEMAFTDDGVLVESTIYRALVHNKAQLAYDAVSDW
IDGKGELPEAARAVHGLDTQLRAQDGLAQKLRVLRRAEGSLEFETFQPRAQFDGERIIDI
RQQVQNRARQLIEELMIATNGCTARYLASNGGLALRRVVRSPERWLRIVDVAKAYGVKLP
NQPDGKALEAFLARQHREDPLRFPDLSLVIVKLMGSGEYVVERSDETPIGHFGLAVQDYM
HSTAPNRRFPDLITQRLVKAALAGVKTPYSPAELVDIATHCTAQEDASRKVERQMRKSEA
ALLLHSRVGQRFAGLVTGVSDHGVWVRIFEPPVEGRLTGDLPELRVGRSVRVRLVSTSVE
RGFIDFALEH
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaaccatgcgttgatcaaccaccgaaccaacctttcgaccctggccgcatgggccatg
ttcagccgggggctggagccggaattccctgtggcggcactcgagcaattggcctccttc
aagggcgcggccacagggtctggtggaggcattcgtgatctcaccgatcgggactggtgt
tcaatcgacaacgatgactcacgcgatctggatcagctctcgctgagcgagccgatgcca
aggggtgggttgcgggtttttgtggccgtggccgatgtggacgcgctggtgaaaaagggc
acgccgatcgatcagcatgcgcaactcaacaccacctcggtctatacctcggcgcgcatc
ttccccatgctgcccgaacggctttcgaccgatctgacctcgctgaaccagggtgaggat
cgactggcgatcgtgagtgaaatggcgttcactgacgatggcgtgctggtggagtcgacc
atttaccgggccttggtgcacaacaaggcgcaactggcctacgacgcggtatcggactgg
atcgatggcaagggtgagctgcccgaggcggcacgggcggttcatggtctggacacccag
ttgcgagcgcaagatggcttggcgcagaagctccgggtgctgaggcgggccgaaggatcg
ctggagttcgagaccttccagcccagagcgcagtttgacggtgagcgcatcatcgacatt
cgccaacaagtgcaaaaccgggcgcgccagttgatcgaagaattgatgattgccaccaat
ggctgcacggcacggtacctcgccagcaatgggggcctcgcgctcaggcgggtggtgcgc
tcgcccgaacgctggctgcgcatcgtggacgtggccaaagcctatggcgtgaagctgccc
aaccagccagacggcaaagcccttgaggcttttttggccagacaacaccgggaagacccg
ctgcgctttccagatctttccttggtcatcgtgaagctgatggggtctggagagtacgtg
gtcgaacgctcagatgaaacgcccattgggcattttggcctggccgttcaagactacatg
cactccaccgcgcccaaccgccgcttccccgatctgatcacgcagcggttggtgaaggcc
gcgctcgctggcgtcaaaacaccgtattccccagcggagctggtggatatcgccacccat
tgcactgcccaggaagatgcctcgcggaaggtggagcggcagatgcgcaagtcggaagcg
gctttgctgctgcattcgcgcgttggccagcgtttcgccggcctggtcaccggtgtgagc
gatcacggcgtctgggtgcggatctttgaaccaccggtcgagggccggctgaccggtgat
ttgcctgagttgagggtgggcaggtccgtgcgcgtgagactggtgtcgacttcagtagag
cgtggctttatcgattttgcgctggagcactga

DBGET integrated database retrieval system