KEGG   Hydrogenophaga sp. LPB0072: LPB072_21830Help
Entry
LPB072_21830      CDS       T04505                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
hyl  Hydrogenophaga sp. LPB0072
Pathway
hyl00061  Fatty acid biosynthesis
hyl00780  Biotin metabolism
hyl01100  Metabolic pathways
hyl01130  Biosynthesis of antibiotics
hyl01212  Fatty acid metabolism
Module
hyl_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:hyl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    LPB072_21830
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    LPB072_21830
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    LPB072_21830
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hyl01004]
    LPB072_21830
Enzymes [BR:hyl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     LPB072_21830
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     LPB072_21830
Lipid biosynthesis proteins [BR:hyl01004]
 Fatty acid synthase
  Component type
   LPB072_21830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AOW15054
UniProt: A0A167GIV5
LinkDB All DBs
Position
4708765..4709568
Genome map
AA seq 267 aa AA seqDB search
MPSETAVVQQPNPFASLAGKRGLVVGVANEHSIAYGCARAIHQLGGALALTYLNDRAKPY
VAPLADELGAEIFMPLDVEQPGQLEAVFERITQQWGKLDFVLHAIAYAPKDDLHGRVVDC
SAEGFARAMNVSCHSFIRMAHLAEPLMTDGGAMVTMSYYGAQKVIGSYGMMGPVKAALES
TVRYLAIELGPKRIRVHAVSPGPIKTRAASGIDHFDALLEQAAQRAPEHQLVSIDEVGAV
TAMLLTDAARGMTGNIAFVDAGYHIVG
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctgaaaccgccgttgtccagcagccgaatccgtttgccagcctggccggaaaa
agggggctggtggtgggtgtggccaacgagcacagcatcgcctacggctgcgcgcgggcc
attcaccaactgggcggtgcgctcgcgctgacctacctcaacgaccgcgcaaaaccctat
gtcgcgccattggccgacgagttgggcgccgagatcttcatgccgctcgatgtcgagcaa
ccgggtcagctcgaggctgttttcgagcgcatcacccagcaatggggcaagctcgacttt
gtgctgcacgccattgcctacgcgcccaaagacgacctgcacggccgtgttgtggattgc
agcgcagaaggtttcgcgcgcgccatgaacgtctcctgccattcgttcatccgcatggcg
cacctggccgagcccctgatgaccgatggcggcgccatggtcaccatgagctactacggt
gcccagaaagtcattggcagctacggcatgatgggcccggtcaaggcggcgctcgaatcc
acggtgcgctatttggccatcgagctggggcccaagcgcattcgcgtgcatgcggtgtcc
ccgggcccgatcaagacccgcgccgcatcgggcattgaccatttcgatgccctgctggag
caggcggcgcaacgcgcgccggaacaccagttggtgagcatcgacgaggtcggcgcggtc
accgccatgctgctcaccgacgccgcccgcggcatgacgggcaacatcgccttcgtcgac
gccggctaccacatcgtgggctga

DBGET integrated database retrieval system