KEGG   Hymenobacter sp. APR13: N008_02565Help
Entry
N008_02565        CDS       T03213                                 

Definition
(GenBank) hypothetical protein
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
hym  Hymenobacter sp. APR13
Pathway
hym00052  Galactose metabolism
hym00511  Other glycan degradation
hym00600  Sphingolipid metabolism
hym01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hym00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    N008_02565
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    N008_02565
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    N008_02565
Enzymes [BR:hym01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     N008_02565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4982 Glyco_hydro_2_C Glyco_hydro_2_N Glyco_hydro_2
Motif
Other DBs
NCBI-ProteinID: AII50863
UniProt: A0A076HNX5
LinkDB All DBs
Position
complement(601804..604272)
Genome map
AA seq 822 aa AA seqDB search
MRFFSFSLSLLSALSLLVLAAAGPTAAQVRQETLLTTDWKFSKGELPDAALPEFNDAQWQ
TVRVPHDWAIYGPFDGNNDLQEVKIEQNQEQKATLKAGRTGGLPFIGTGWYRRRLAVPGF
GPGRRAVLLFDGAMSNARVFVNGREVGFWPYGYNSFSFDITSFLKPTGADNVLAVRLQNQ
PEASRWYPGAGLYRNVHLIITDDVHIPVWGTYLTTPEISASQATVQLRTQVAGAGSAANL
RLETEIRDAAGRVLTTTSTPLAAGAAAVEQRLLVAAPKLWSPETPVLYTASSKLFAGETL
KDTYVTRFGIRSFKFEANKGFSLNGQLRKFRGVCNHHDLGPLGAAVNVAALRRQLTLLKD
LGADAIRTTHNMPAPELVSLADELGFMLIVESFDEWKKPKVKNGYSQYFDEWAEKDLVNM
VHRDRNHPSVILWSIGNEVPDQWAPGGVAIAKRLQDIVHREDPTRPVTAGMDQFDAAVNN
GFAALLDVPGFNYKPNRYLEARAKLPQGLMLGSETASTVSSRGVYKFPVELAKQKKYPDN
QSSSYDLESCVWSQTPDEEFVMQDSLRYVLGEFVWTGFDYLGEPTPYDEAWPSHSSYFGI
LDLAGLPKDRYYLYRARWNPAPTLHLLPHWTWPGRENQTTPVFCYTNYPEAELFVNGQSQ
GRRRKTTTGSPQARYRLMWNDVKYAPGTLKVVAYDAAGQPVATEEVHTASAPHHIRLTTD
RATLRADGEDLAYVTARVEDAQGNLCPEATNQLQFAVRGAGRFRAAANGNAASLELFHEP
QMKAFQGQLAVLVQAIDKAGKAQLEVSSPGLKSAVLKLKTAK
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttcttctctttttctctatccctgctgagtgccctgagcctgctggttctggcc
gctgcgggcccgacggcagcccaggtgcggcaggaaaccctgctgaccaccgactggaag
ttcagcaagggcgagctgcccgacgcggctctgccggagttcaacgacgcccagtggcaa
accgtgcgcgtgccccacgactgggccatttacggccccttcgatggcaacaacgatttg
caggaagtgaaaatcgagcagaaccaggagcagaaggctactctaaaagcgggccgcacc
ggtgggctgccgttcatcggcacgggctggtaccggcggcgcttagcggtgccgggcttc
gggccgggccggcgggcggtgctgctttttgatggggccatgagcaacgcgcgcgtgttc
gtgaacggccgcgaggtagggttctggccttacggctacaactcgttttccttcgacatc
accagctttctgaaacccaccggcgccgacaacgtgctggccgtgcgcctgcaaaaccag
cccgaagcctcgcgctggtaccccggcgccggcctgtaccgcaacgtgcacctcatcatc
accgacgacgtgcacattccggtgtggggcacctacctgaccacgcccgaaatcagtgcc
agccaagccaccgtgcagctgcgcacgcaggtagccggcgcgggctcggccgccaatctg
cggctggaaaccgaaatccgcgatgcggccggccgggtcttgaccaccacttccacgccg
ctggcggcgggcgcggcggccgtggagcagcgcctgctggtggcggctcccaaactctgg
tcgccggaaacgccggtgctctacacggcttcctcgaagctgtttgccggcgaaacgctg
aaggatacgtacgtgacgcgcttcggaattcgctctttcaagttcgaggcaaacaagggc
ttctccctgaacgggcagttgcgcaagttccggggcgtgtgcaaccaccacgacctgggc
ccgctgggcgcggccgtgaacgtagccgcgctgcgccgtcagctcacgctgctcaaggat
ttgggcgccgatgccatccggaccacccacaacatgccggctccggaactggtgagcctg
gccgacgaactgggcttcatgctgattgtggagtcgtttgacgagtggaaaaagcccaag
gtgaagaacggctacagccagtacttcgacgagtgggccgaaaaggacctggtgaacatg
gtgcaccgggaccgaaaccatccgtcggttattctatggagtatcggcaacgaggtgccc
gaccagtgggcgccgggcggcgtggccatagccaagcgcctccaagacattgtgcaccgc
gaggaccccacgcgccccgtcacggccggcatggaccagtttgatgcggccgtgaacaac
ggctttgccgcgctgctcgacgtgccgggcttcaactacaaacccaaccgctacctagaa
gcccgcgccaagttgccccagggtttgatgctgggctccgaaacggcttccacggtgagc
agccggggcgtgtacaagtttccggtggagctggccaagcagaagaagtaccccgacaac
cagtcgtcgtcgtacgacctggaatcatgcgtgtggtcgcagacgcccgacgaggagttt
gtgatgcaggattcgctgcgctacgtgctgggcgagttcgtctggaccgggttcgactac
ctgggcgagcccacgccctacgacgaggcctggccgtcgcacagctcctacttcggcatt
ctggacctggcaggcctacccaaggaccggtactacctctaccgggcccgctggaacccc
gcgcccacgctgcacctgctgccccactggacctggcctggtcgcgaaaaccagaccacg
cctgtgttctgctacaccaactaccccgaggccgagctgttcgtgaacggccagagccag
ggccgccgccgcaaaaccaccaccggctccccgcaggcccgctaccgcctgatgtggaac
gacgtgaaatacgcgcccggcaccctgaaagtggtggcctacgatgccgctggccagccc
gtagccaccgaagaagtacacaccgccagcgccccgcaccacatccgcctcaccactgac
cgcgccaccctccgcgccgatggtgaggacctggcctacgtgacggcccgcgtggaggac
gcccaggggaacctctgccccgaagccaccaaccagctgcagtttgccgtgcgcggtgcc
ggccggttccgggccgcggccaacggcaacgccgcgagcctggagttgttccacgagccg
cagatgaaggcgtttcagggccagctggcggtgctggtgcaagccatcgataaagccggc
aaagcgcagctggaagtcagcagccccggcctgaaaagcgccgtgctgaagctgaagaca
gcgaagtag

DBGET integrated database retrieval system