KEGG   Hymenobacter sp. APR13: N008_05380Help
Entry
N008_05380        CDS       T03213                                 

Definition
(GenBank) hypothetical protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
hym  Hymenobacter sp. APR13
Brite
Enzymes [BR:hym01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     N008_05380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AII51416
UniProt: A0A076HPM4
LinkDB All DBs
Position
1239684..1240292
Genome map
AA seq 202 aa AA seqDB search
MAFELPKLPYDYAALEPHIDAQTMEIHHSKHHQAYVTNLNNAVAGTELEGKSLEDLMQNI
ASAPAAVRNNGGGHWNHSFFWQILGPNGGGEPTGAVGEAINKAFGSYEKFKEEFTKAATT
RFGSGWAWLCKQADGSVKICSTPNQDNPLMPDAGCQGTPVLGLDVWEHAYYLKYQNRRPD
YVAAFYNAINWDEVNKRFAEAA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaactgcccaaactgccctacgactacgccgccctggagccgcacattgat
gcgcagaccatggaaatccaccatagcaagcaccatcaggcttatgttaccaacctcaac
aatgccgtagccggcaccgagctggaaggcaaaagcctcgaagatttgatgcagaacatt
gcctcggctccagccgcggtgcgcaacaacggcggtggccactggaaccactccttcttc
tggcagatcctcggcccgaacggtggcggtgagccaaccggtgccgtaggcgaagccatc
aacaaggccttcggcagctacgagaagttcaaggaagaattcacgaaggccgccactacg
cgcttcggctcgggctgggcgtggctgtgcaagcaggccgacggctccgtgaaaatctgc
tcgacgcccaaccaggacaacccgctgatgcccgacgccggctgccagggcacgcccgtc
ctgggcctcgacgtgtgggagcacgcctactacctcaagtaccagaaccgccgccccgac
tacgtggccgccttctacaatgccatcaactgggacgaagtgaacaagcgcttcgccgaa
gccgcttag

DBGET integrated database retrieval system