KEGG   Hymenobacter sp. APR13: N008_06305Help
Entry
N008_06305        CDS       T03213                                 

Definition
(GenBank) hypothetical protein
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
hym  Hymenobacter sp. APR13
Pathway
hym00473  D-Alanine metabolism
hym01100  Metabolic pathways
hym01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hym00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    N008_06305
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    N008_06305
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hym01011]
    N008_06305
Enzymes [BR:hym01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     N008_06305
Peptidoglycan biosynthesis and degradation proteins [BR:hym01011]
 Precursor biosynthesis
  Racemase
   N008_06305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AII51594
UniProt: A0A076HVF3
LinkDB All DBs
Position
complement(1466009..1468507)
Genome map
AA seq 832 aa AA seqDB search
MLDFSADLPALTSGTLLLTPPAPAPVQTLLLDSRRVGQAGGSVFFALRGPQHNGHRYLPE
LYQQGVRLFVVDSEVDIPGGLLAYPGSGFLLVPQVLDALQAVAAAHRRQFRLPVLGITGS
NGKTIVKEWLAQLLAPEERICKSPRSYNSQVGVPLSVWELNARHTLGVFEAGVSEPGEMA
RLAAVIQPTLGLFTNLGTAHDAGFASHQQKVEEKMQLFRDVDTLFYCLDHQIIHEAAQRL
LPAHRTFTWSRQHPHLAHVAVTVAEASADRTVVRVTLARPVPQEHTFTLPFADEPSVENA
LHALSVLLWQQVPAAEIQHRLDRLQPVAMRLEMKQALNDCYVLDDTYNNDLAGLALALDA
LTRQLQRGRRTLILSDVLESGLAGPDLYARVAALLRTHGVARLVGIGPEIRLHQGAFDGI
EAVFYDTTEDFLRHFQPDTFRRETILVKGARRFGFERIVAAFQQKIHGTVLEVNLDALAH
NLNFYRRRLQPGTRLMVMVKAFAYGSGSSEVANLLQFHRADYLAVAYTDEGVDLRQHGIS
LPIMVMNPSPDAFQKLRQYQLEPEIYSFERLHDYLRAAREQPLPPIHLKLDTGMRRLGFA
ETDLPELTRLLRENAAHLRVASALTHLAGADEEQHNDFSRQQLAAFHRMTPVLEAVLGYP
ILKHALNSAGILRFPAAHADMVRLGIGLYGVEASGQEPDALQPVSTLRTTVSQVKALPPG
ETVGYGRRGQAADFERRIATLAIGYADGYDRRFGNGAGEVVIRGQRAPIVGNVCMDMCMA
DVTHISGAQAGDAAEIFGPSLPLPELAARIGTIPYELLTNVSERVKRVFVAE
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatttctctgccgacctgcccgccctcaccagtggcaccctgctgctgactccg
cccgcccccgcgcccgtccagaccttgctgctggacagccgccgcgtgggtcaggccggc
ggcagcgtgttctttgcgctgcgcggaccccagcacaacggccaccgctacctgcccgag
ctctaccagcagggcgtgcgcctgtttgtggtggatagcgaagtcgatattcccggcggg
ctgctggcctaccccggcagcggctttctgctggtgccgcaggtgctggacgcgctgcag
gccgtggctgccgcccaccgccgccagtttcggctgcccgtgctgggcatcaccggctcc
aacggcaaaaccatcgtgaaggagtggctcgcgcagctgctggctcccgaggaacgcatc
tgcaaaagcccacgctcctacaactcgcaggtgggtgtgccgctgagcgtgtgggagctg
aacgcccgccacacgctgggtgtcttcgaagccggcgtgtcggagcccggcgaaatggcg
cggctggcggccgtaatccagcccacgctgggcttgttcaccaacctgggcaccgcccac
gacgccggctttgcctcccatcagcagaaagtggaagagaagatgcagctgttccgcgac
gtggatacgctgttctactgcctcgaccaccagatcattcacgaagctgcccaacgcctg
ctgcccgcgcaccgcaccttcacctggagccgccagcacccgcacctggcccacgtggcc
gtgacggtggccgaggccagcgccgaccgcaccgtggtgcgcgtaacgctggcccggccc
gtgccgcaggagcacaccttcactctgcccttcgccgacgagcccagcgtggaaaatgcc
ctgcacgcgctgtcggtgctgctgtggcagcaggtgcccgccgccgaaatccagcaccgc
ctcgataggctgcagcccgtggccatgcgcctggagatgaagcaggccctcaacgactgc
tacgtcctcgacgacacctacaacaacgacctcgccggcctcgccctggccctcgacgcc
ctcacgcgccagctgcagcgcggccgccgcaccctcatcctctccgacgtgctcgaatcc
ggcctcgccggccccgacctctacgcccgcgtggccgccttgctgcgcacccacggcgtg
gcgcgtctcgttggcatcggccccgaaatccgcctgcaccaaggcgcttttgatgggata
gaggctgtgttttacgataccaccgaggactttctgcgccacttccagcccgacaccttc
cgccgcgaaaccattttggtgaagggggcgcgccgctttggcttcgagcggattgtggcg
gcgtttcagcagaaaatccacggcacggtgctggaagtcaacctcgatgcgctggcccac
aacctcaacttctaccgccgccgcctgcagcccggcacccgcctcatggtgatggtgaag
gccttcgcgtacggcagcggctcctccgaagtcgccaacctgctgcagttccaccgcgcc
gactacctggccgtggcctacaccgacgaaggcgtggacctacgccagcacggcatcagc
ctgcccatcatggtgatgaacccctcgccggatgccttccagaagctgcgccagtaccag
ctggagcccgaaatctactccttcgagcgtctgcacgactacctgcgcgccgcccgcgag
cagccgttgccgcccatccacctcaagctcgataccggcatgcgccgcctcggcttcgcc
gaaaccgacttgcccgagctgacccgactgctgcgcgaaaacgctgcccatctgcgcgtg
gccagcgccctcacccacttggccggcgccgacgaagagcagcacaacgacttctcgcgg
cagcagctggccgccttccaccgcatgacgccggtgctggaagccgtgctcggctacccc
attctcaagcacgcgctcaactcggccggcatcctgcgcttcccggccgcccacgccgat
atggtgcgcctcggcatcgggctgtatggggtagaagccagcggccaggagcccgacgcc
ctgcagcccgtgagcacgctgcgcaccaccgtgtcgcaggtgaaagcgctgccgcccggc
gaaaccgtcggctacggccgccgcggccaggccgccgacttcgagcggcgcattgccacg
ctggccatcggctacgccgacggctacgaccggcgcttcggcaacggcgcgggcgaggtg
gttatccggggccagcgcgcgcccatcgtcggcaacgtgtgcatggacatgtgcatggcc
gacgtcacgcacatcagcggcgcccaggccggcgacgcggccgaaatcttcggccccagc
ctgccgctgcccgagctggcggctcgcattggcaccattccgtatgagctgctgaccaac
gtaagcgagcgggtgaagcgcgtatttgtggccgaataa

DBGET integrated database retrieval system