KEGG   Hymenobacter sp. APR13: N008_07385Help
Entry
N008_07385        CDS       T03213                                 

Definition
(GenBank) hypothetical protein
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
hym  Hymenobacter sp. APR13
Pathway
hym00380  Tryptophan metabolism
hym01100  Metabolic pathways
Module
hym_M00038  Tryptophan metabolism, tryptophan => kynurenine => 2-aminomuconate
Brite
KEGG Orthology (KO) [BR:hym00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    N008_07385
Enzymes [BR:hym01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     N008_07385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AII51805
UniProt: A0A076HPL7
LinkDB All DBs
Position
complement(1741707..1742990)
Genome map
AA seq 427 aa AA seqDB search
MTSFEPTAEFAAQLDAQDPLRDFRHQFHIPPGPDGQDSIYLCGNSLGLQPKTARAAVERQ
MQNWQELAVEGHFRGDTPWMTYHERLEQATAHIVGAKPLEVTVMNNLTTNLHLLLVSFYQ
PTPTRYKVLMEGGAFPSDQYALETQVQMRGFRPDDAIVELVPRPGEHTLRTEDIVARIAE
LGDSLCTIIMGGINYYTGQVYDMAAITQAGHAVGARVGFDLAHAAGNIPLQLHDWDVDFA
CWCSYKYLNSGPGGVSGAFVHERFADQPELLRLAGWWGYEEKERFKMKKGFRPMRGAAGW
QLSNGAVLTLAAHEAALNIHEAAGGMAALRRKSEQLTAYLEFLIRGLALPAGTLEIITPQ
DPAARGCQLSILVQKDGRQLFDYLMGKGIIGDWREPNVIRLAPVPLYNSFQDVQRVGAAL
AEWRVTE
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgacctccttcgaacccaccgccgaattcgccgcccaacttgatgcgcaggacccgctg
cgcgacttccgccaccagtttcatatcccgcccggccccgatgggcaggacagcatctac
ctgtgcggcaactccctgggtttgcagcccaaaaccgcccgcgccgccgtggagcgccag
atgcagaactggcaggagctggccgtggaaggccacttccgcggcgacacgccctggatg
acctaccacgagcgcctggagcaggccacggcccacattgtgggcgccaagccgctggaa
gtgacggtgatgaacaacctcaccaccaacctgcacctgctgctggtgtcgttctaccag
cccacgcccacccgctataaggtgctcatggaaggcggcgctttcccgtccgaccaatac
gccctcgaaacgcaggtgcagatgcgcggcttccgccccgacgacgccattgtggagctg
gtgccgcgccccggcgagcatacgctgcgcaccgaggacatcgtggccaggattgccgag
ctcggtgattcgctgtgcaccatcatcatgggcggcatcaactactacaccgggcaggta
tacgacatggcggccatcacgcaggccggccacgccgtgggcgcccgcgtggggttcgac
ttggcccacgccgccggcaacattccgctgcagctgcacgactgggacgtggattttgcc
tgctggtgctcctacaagtacctcaactcgggccccggcggcgtgtcgggcgcgtttgtg
cacgagcggttcgccgaccagcccgagctgctgcgcctggccggctggtggggctatgag
gagaaggagcgattcaagatgaaaaagggtttccggcccatgcggggcgcggccggctgg
cagctctccaacggcgccgtgctcacgctggccgcccacgaagccgccctcaacatccac
gaagctgccggcggtatggccgccctgcgccgcaaaagcgagcagctcacggcctatctg
gagttcctgatccgggggctggcgctgccggccggcacgctggaaatcatcaccccccag
gaccctgccgcccgcggctgccagctgtccatcctggtgcaaaaggatggccgccagcta
ttcgactacctgatgggcaaaggcatcatcggcgactggcgcgagcccaacgtcatccga
ctggccccagtgccgctctacaactccttccaggacgtgcagcgcgtaggcgccgccctg
gcggagtggagagtaactgagtaa

DBGET integrated database retrieval system