KEGG   Hymenobacter sp. APR13: N008_14685Help
Entry
N008_14685        CDS       T03213                                 

Definition
(GenBank) hypothetical protein
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
hym  Hymenobacter sp. APR13
Pathway
hym00270  Cysteine and methionine metabolism
hym00450  Selenocompound metabolism
hym01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hym00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    N008_14685
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    N008_14685
Enzymes [BR:hym01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     N008_14685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AII53217
UniProt: A0A076HX60
LinkDB All DBs
Position
complement(3456922..3458232)
Genome map
AA seq 436 aa AA seqDB search
MTNPADHACINGQRLNPESLMMSYGYTPAWSEGAIKPPIFQTSTFVFRNAEEGKAFFELA
YGLRQQRPDEEMGLIYSRLNNPSLEILEHRLCLWDEAEEAASFASGMAAISTTLLALLQP
GDVVLHSEPVYGGSDFFLKNVLRKFGIEAVGFRPTATPQEMEALAAGIAPGRLAMLFVET
PANPTNHLVDLEACAALARRHSTAEKPVRLVVDNTFLGPVFQHPLKHGADVVLYSATKFL
GGHSDLIAGAALSSRALMKEIKAMRTFMGTMCDPNTGWMLMRSLETLKLRMERAATSAQL
IADWLREHPLVARTYYLTHLEHCPVQQDIYQRHCLAPGSMISFDIRGGEAEAFRFLNALR
LIKLAVSLGGTESLAEHPATMTHSDITPAEQHEMGISPRMIRLSIGVEDPRDLMLDLSQA
FEAVGLPQAVREVEMA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaccccgccgaccatgcctgcatcaacgggcagcgcctgaaccccgaaagcctg
atgatgagctacggctacacgccagcctggagcgaaggcgccatcaagccgcccattttc
cagacctccactttcgtgttccggaacgccgaggaaggcaaggccttcttcgagctggcc
tacggcctgcgccagcagcgccccgacgaggaaatgggcctgatttattcccgcctcaac
aaccccagcctggaaattctggagcaccgcctctgtctttgggacgaagccgaggaagcc
gcgtccttcgcctcgggcatggccgccatcagcaccaccctgctggcgctgctgcagccc
ggcgacgtggtgctgcactccgagcccgtgtacggcggctccgacttcttcctgaaaaac
gtgctgcgcaagttcggcatcgaggccgtgggcttccgacccaccgccacgccccaggaa
atggaggctttggccgctggtattgcgcccggccgcctggccatgttgtttgtggaaacg
cccgccaaccccaccaaccacctcgtagacctggaagcctgcgccgccctggcccgccgc
cacagcaccgccgaaaaacccgtgcgtctggtagtagacaataccttcctcggcccggtg
ttccagcacccgcttaagcatggagccgatgtggtgctgtactcggccaccaagtttctg
ggcggccactccgacctcattgccggcgccgccctcagcagccgcgccctcatgaaggaa
atcaaggccatgcgcacctttatgggcaccatgtgcgaccctaacaccggctggatgctg
atgcgcagcctcgaaaccctgaagctgcgcatggagcgcgccgccacctccgcccagctc
attgccgactggctgcgggagcacccgctggtggcccgcacttactaccttactcacctg
gagcactgccccgtgcagcaggatatctaccagcgccactgcctcgcgccgggctccatg
atttcgtttgacatccggggcggcgaggcggaggccttccgcttcctcaacgcgctgcgc
ctcatcaagctggccgtgagcctgggcggcaccgaaagcctggcggagcaccccgccacc
atgacccactccgacatcacgcccgccgagcagcacgaaatgggcatctctccccggatg
attcgcctcagcatcggcgtggaggacccgcgggacctgatgctggacctgagccaggcg
tttgaggctgtgggcctgccgcaagcggtgcgggaggttgaaatggcctaa

DBGET integrated database retrieval system