KEGG   Hymenobacter sp. APR13: N008_16255Help
Entry
N008_16255        CDS       T03213                                 

Definition
(GenBank) hypothetical protein
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
hym  Hymenobacter sp. APR13
Brite
KEGG Orthology (KO) [BR:hym00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hym01002]
    N008_16255
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hym04147]
    N008_16255
   04090 CD molecules [BR:hym04090]
    N008_16255
Enzymes [BR:hym01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     N008_16255
Peptidases [BR:hym01002]
 Metallo Peptidases
  Family M2
   N008_16255
Exosome [BR:hym04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   N008_16255
CD molecules [BR:hym04090]
 Proteins
  N008_16255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: AII53522
UniProt: A0A076HY16
LinkDB All DBs
Position
3832822..3834678
Genome map
AA seq 618 aa AA seqDB search
MKRYFLPTLTAAALLTACAPTAKTPTATTAPTAAPEPATQPAVPRWDERAETFLKAYSAE
YQRLYTQATEAEWRSNTHIVPGDTSNAGATARANERMAAFTGSAANIQELRELLDHKDQL
TELQVKQLQTALYNAANSPQTIADVVKRRIKAEAAQTEKLYGFDYKYAGKSVTTNDLDEL
LRKEKNPLKRQQIWEASKEIGPTLKDGLLNLRDLRNQTVQALGYPDYFTYQASDYGLSRE
EMLTLVRKLNDELRPLYRELHTYARYELAKKYGQKQVPDYLPASWLPNRWGQDWSAMVDV
KGLDLDPVLAKKGAEWQVKQAERFYQSLGFPALPPVFYEKSSLYPLPAGAAYKKNNHASA
WHMDLNQDVRSLMSVEGNTEWYETTHHELGHIYYYLTYTNPDVPVLLRGGANRAYHEAMG
SLMGLAATQKPFLAGLGLVDAKSKTDQTQTLLKEALNYATFIPFASGVMSEWENSFYADK
LPADQLNAKWWELAKKYQGIVPPTTRGEQYLDPATKTHINDDPAQYYDYALSYVILFQLH
DHISKNILKQDPHATNYYGSKEVGAFLADIMRPGASKDWRTVLKEKTGEDLSARAMVEYF
QPLMAYLKEQNKGRKYTM
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgctacttcctgcccaccctcacggcggcggccctgctgacagcctgcgcgccc
accgccaaaacgcccacggccaccacagcccccaccgccgcacccgagccggccacccag
cctgccgtcccccgctgggacgagcgcgccgagaccttcctcaaggcctattctgccgag
taccagcgcctctacacccaggccaccgaggccgaatggcgttccaacacccacattgta
cccggcgacaccagcaacgctggggccacggcccgcgccaacgagcggatggcggccttc
acgggctcagcggccaacatccaggagctgcgcgaactgctcgaccacaaagaccagctc
acggagctgcaggtgaagcagctgcaaacggccctctacaacgccgccaactcgccccag
accattgccgacgtggtgaagcgccgcatcaaggccgaagccgcccagaccgagaagctc
tacggcttcgactacaagtacgccggcaagtccgtcacgaccaacgacctggatgagctg
ctgcgcaaggaaaagaacccgctgaagcgccagcagatctgggaagccagcaaggaaatc
ggccccacgctcaaagacggcctgctcaacctgcgcgacctgcgcaaccagaccgtgcag
gccctcggctaccccgactacttcacctaccaggcctccgactacggcctgagccgtgag
gaaatgctgacgctggtgcgcaagctcaacgacgagctgcgcccgctctaccgcgagctg
cacacctacgcccgctacgagctggccaaaaagtacggccagaagcaggtgcccgactac
ctgccggcctcctggctgcccaaccgctggggccaggactggagcgccatggtcgacgtg
aaaggcctcgacctcgacccggtattggccaaaaaaggggcggagtggcaggtgaagcag
gccgagcggttctaccagagcctgggcttcccggccctgccgccggtcttctacgagaaa
tccagcctctacccgctgcccgccggcgcggcgtataagaaaaacaaccacgcctcggcc
tggcacatggaccttaatcaggacgtgcgtagcctgatgagcgtggagggcaacactgag
tggtacgaaaccacccaccacgagctgggccacatctactactacctcacctacaccaac
cccgacgtgccagtgctgctgcgcggcggcgccaaccgcgcctaccacgaggccatgggc
agcctgatgggccttgccgccacccagaagccctttctggccggcctgggtttggtagat
gccaagtcgaaaaccgaccagacccagacgctgctcaaagaagccctcaactacgccacc
ttcatcccgtttgcctcgggcgtgatgagcgagtgggaaaacagcttctacgccgacaag
ctgcccgccgaccagctgaatgccaaatggtgggaactggccaaaaagtaccagggcatc
gtgccgcccaccacgcgcggcgagcagtacctcgacccggccaccaaaacccacatcaac
gacgaccccgcgcagtactacgactacgctctgagctacgtcatcctgttccagctccac
gaccacatcagcaaaaacatcctcaagcaggacccgcacgccaccaactactacggcagc
aaggaggtgggcgcgtttctggctgacatcatgcggcccggcgccagcaaggactggcgc
accgtgctgaaagagaaaaccggcgaagacctgtcggcccgcgccatggtggagtatttc
cagcccctgatggcctacctgaaagagcagaacaaaggccgtaaatacaccatgtaa

DBGET integrated database retrieval system