KEGG   Hymenobacter sp. APR13: N008_19105Help
Entry
N008_19105        CDS       T03213                                 

Definition
(GenBank) hypothetical protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hym  Hymenobacter sp. APR13
Pathway
hym00564  Glycerophospholipid metabolism
hym01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hym00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    N008_19105
Enzymes [BR:hym01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     N008_19105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 HI0933_like Pyr_redox_3 GIDA NAD_binding_8 Thi4 Pyr_redox DNA_binding_1
Motif
Other DBs
NCBI-ProteinID: AII54081
UniProt: A0A076HX05
LinkDB All DBs
Position
complement(4460214..4461791)
Genome map
AA seq 525 aa AA seqDB search
MHHFTRETHLTQIAETLVWDVLIIGGGATGLGVAVDAASRGYRTLLLERADFAQGTSSRS
TKLVHGGVRYLAQGQIGLVREALRERARLLQNAPHLAHRQAFVIPCYRWWERPWYLLGLK
LYDLLAGRQGIGGAHLLNAAEAAQHLPGVQPAGLRGGVRYFDGQFDDARLALTLARTAAN
HGATVLNYMAVTALQKDAAGRVCGATAHDQETGRTYTLQAKVVVNATGVFVDEVLHLDTP
AAAPLVRPSQGVHVVLPADFLPGPEALMIPQTPDGRVLFAVPWLGRVVVGTTDTLVPQAT
PEPRAQAEEIRFILETAGRYLTRPPQLRDVLSTWAGLRPLAAPAQAGAATKEISRSHKLL
VSESGLLTITGGKWTTYRQMAEDVVNRAQQLGSLPVQACRTAVLPLHGAPASNLPLPNAA
LAAYGSDASALQQLLTENPAWAAPVAPGFPYVWAEVVWAIRHEMARTVPDVLARRLRLLF
LDACAALAAAPAVAQLLAIELGRSEAWQQQQVAEFKELAAGYLTP
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgcaccacttcacccgcgaaacccacctcactcaaatcgctgaaaccctcgtctgggac
gtgctcatcatcgggggcggggccacggggctgggcgtggccgtggacgccgccagccgc
ggctaccgtacgctgctgctggagcgcgcagattttgcccagggcaccagcagccgcagc
accaagctggtgcacggcggcgtgcgctacctggcccagggccagatagggctggtgcgt
gaggccctgcgcgagcgggcccggctgctgcaaaatgccccgcacctggcacatcggcag
gccttcgtgattccgtgctaccggtggtgggagcggccctggtatctgctgggcctgaag
ctctacgacctgttggccggccgccagggcattggcggggcccacctgctgaacgcggcc
gaagccgcccagcacctgccgggcgtgcagcccgcgggcctgcgcggcggcgtgcgctac
ttcgacgggcagtttgacgatgcccgcctagccctcacgctggcccgcaccgccgccaac
cacggcgctaccgtcctcaactacatggccgtaacggcgctgcagaaagacgccgccggc
cgcgtgtgcggcgctacagcccacgaccaggaaaccggccgcacctacacgctgcaggcc
aaagtggtggtaaatgccaccggcgtgttcgtggatgaagtgctgcacctcgacacgccc
gccgccgcgccgctggtgcgccccagccagggcgtgcacgtggtgctgcccgccgacttt
ctgcccggccccgaggccctcatgattccacagacgcccgacggccgggtgctgtttgcg
gtgccgtggctgggccgggtggtggtgggcaccaccgatacgttggtgccgcaagccact
cccgagccccgtgcccaggccgaagaaatccgcttcattctcgaaaccgccggccgctac
ctcacgcgcccgccgcagctacgcgacgtgctcagcacctgggccggtctgcgcccgctg
gccgcgccggcgcaagccggggctgccaccaaggagatttcgcgcagccacaagctgctg
gtatcagagtcgggcctgctcaccatcacgggcggcaaatggaccacctaccgccagatg
gccgaggacgtggtaaaccgcgctcagcaactgggaagcttgcccgtgcaggcctgccgc
accgccgtattgcccctacacggtgctcccgcctccaacctgccactgcccaatgcggca
ctggccgcgtatggttccgacgcgtcggcgctgcagcaattgctaaccgaaaaccccgcc
tgggcggcgccggtagcgcccggcttcccctatgtgtgggccgaagtggtgtgggccatc
cgccacgaaatggcccgcaccgtgcccgacgtgctggcccggcgcctgcggctgctgttt
ctggatgcctgcgccgcgctggccgccgctccggcggtggcgcagctgctggccattgag
ctgggacgttccgaagcctggcaacagcagcaggtagcggagttcaaggagctagcggcc
gggtacctcaccccctaa

DBGET integrated database retrieval system