KEGG   Hydrogenophaga sp. BPS33: F9K07_18225Help
Entry
F9K07_18225       CDS       T06379                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
hyn  Hydrogenophaga sp. BPS33
Brite
KEGG Orthology (KO) [BR:hyn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    F9K07_18225 (ahpF)
Enzymes [BR:hyn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     F9K07_18225 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 DAO K_oxygenase FAD_binding_3 HI0933_like Glutaredoxin AlaDh_PNT_C Thi4 FMO-like NAD_binding_8 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: QHE86697
LinkDB All DBs
Position
complement(3925580..3927169)
Genome map
AA seq 529 aa AA seqDB search
MLDDNLKAQLGAYLERVTQPFEIVASLSDSENSREMRDLLQTIQGLRSDKITVKTDGQDG
RKPSFTLQRAGSDTSLRFAGLPLGHEFTSLVLALLWTGGHPPKVEPDVIEQIQALDGDFN
FEVYMSLTCHNCPDVVQALSLMAILNPKVKTTVIEGGAFQNEVTEREIMAVPIVFLNGKE
FGSGRMTVEEIVAKLDVNADAREAAKLDAKEPYDVLIVGGGPAGAAAAVYAARKGIRVGV
AAERFGGQVNDTMGIENYPSVIETNGPAFAAALEAQVRHYDVEIMNLQTAAKLIPASEPN
GLVQVQMTHGGTLSARSVILSTGARWRNVNVPGEAEYKNKGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVKHVTLVEFADALKADAVLVSKLKSLPNVDIHVNAQTTEITGA
EGKVNGLSFKDRVSGEQHHVELEGVFVQIGLVPNTEFLKGTVALSRFGEIEIDAKGHTNV
DGVFAAGDCTTVPYKQIVVAAGAGSTAALSAFDYLIRQPVVAPAEAVAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgacaacctcaaggcacaactcggcgcgtatctcgagcgcgtgacacaaccc
ttcgagatcgtcgcctccctgagcgactctgagaactcccgggaaatgcgcgatctgctg
cagaccatccagggcctgcgcagcgacaagatcaccgtcaagaccgacgggcaggacggg
cgcaagccgtccttcaccctgcagcgcgcgggcagcgacacatcgctgcgctttgccggt
ctgccgctgggccacgagttcacctccttggtgctggcgctgctgtggaccggtggtcac
ccgcccaaggtcgagccggatgtgatcgaacagatccaggcgctggacggtgacttcaac
ttcgaggtctacatgtccctgacttgccacaactgcccggacgtggtgcaggcgctgagc
ctgatggcgatcctgaaccccaaggtcaagaccacggtcatcgaaggcggtgcgttccag
aacgaagtgaccgagcgggagatcatggctgtgccgatcgtcttcctcaacggcaaggag
ttcggttcgggccgcatgacggtggaggagatcgtcgccaagctcgacgtgaacgccgat
gcccgcgaggctgccaagctcgatgccaaggaaccgtacgacgtgctcatcgtcggcggt
ggcccggccggcgcggcagcggcggtgtacgcggcgcgcaagggcattcgcgtgggcgtg
gcggccgagcgcttcggtggccaggtcaacgacaccatgggcatcgaaaactaccccagc
gtcatcgagaccaacggcccggcgttcgccgcggcgctcgaagcacaggtgcgccactac
gacgtggagatcatgaacctccagaccgcggccaagctcattcccgcgagcgaacccaac
ggcctggtgcaagtgcagatgacccacggcggcaccctgagtgcgcgcagcgtgatcctg
tccaccggtgcgcgctggcgcaacgtgaacgtgcccggcgaggccgagtacaagaacaag
ggcgtggcctactgcccgcactgcgatggcccgttgttcaagggcaagcgcgtggcggtg
atcggtggtggcaactcgggcgttgaagcagccatcgacttggccggcatcgtgaagcac
gtgacgctggtcgagttcgccgatgcgctcaaggccgacgcggtgctggtgagcaagctc
aagagcctgcccaacgtggacatccacgtgaacgcgcagaccaccgagatcaccggagcc
gagggcaaagtcaatggtctgagcttcaaggaccgcgtgagcggcgagcagcaccacgtc
gaactcgaaggtgtgttcgtgcagatcggcctggtgcccaacaccgaattcctcaaaggc
acggtggcgttgagccgctttggcgagatcgagatcgatgccaagggccacacgaatgtg
gatggcgtgtttgcggcgggtgactgcacgacggttccgtacaagcagatcgtggtggcc
gcgggtgcgggttcgacggcggcgctcagcgcgttcgattacctgatccgccagccggtg
gtggcgccggccgaagctgttgccgcctga

DBGET integrated database retrieval system