KEGG   Hydrogenimonas sp. MAG: NNO_0816Help
Entry
NNO_0816          CDS       T05789                                 

Definition
(GenBank) aspartate aminotransferase
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
hyo  Hydrogenimonas sp. MAG
Pathway
hyo00220  Arginine biosynthesis
hyo00250  Alanine, aspartate and glutamate metabolism
hyo00270  Cysteine and methionine metabolism
hyo00330  Arginine and proline metabolism
hyo00350  Tyrosine metabolism
hyo00360  Phenylalanine metabolism
hyo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hyo00401  Novobiocin biosynthesis
hyo01100  Metabolic pathways
hyo01110  Biosynthesis of secondary metabolites
hyo01130  Biosynthesis of antibiotics
hyo01210  2-Oxocarboxylic acid metabolism
hyo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hyo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NNO_0816
   00270 Cysteine and methionine metabolism
    NNO_0816
   00220 Arginine biosynthesis
    NNO_0816
   00330 Arginine and proline metabolism
    NNO_0816
   00350 Tyrosine metabolism
    NNO_0816
   00360 Phenylalanine metabolism
    NNO_0816
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NNO_0816
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    NNO_0816
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hyo01007]
    NNO_0816
Enzymes [BR:hyo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     NNO_0816
Amino acid related enzymes [BR:hyo01007]
 Aminotransferase (transaminase)
  Class I
   NNO_0816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Alliinase_C Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: BBG65519
UniProt: A0A3G9GUX5
LinkDB All DBs
Position
complement(788699..789904)
Genome map
AA seq 401 aa AA seqDB search
MDKIKVKKGYHMLSDRIQTLSESLTMAITALAQQLKREGKDILGFSAGEPDFDTPQVIKD
AAIRAINEGFTKYTPVDGIPELKEAIVEKLRRDNGLSYATDQVIASNGAKQSLFNLFQAT
INPGDEVIIPAPYWVTYPELVKYSGGVPVVIETDDSSGFKITPQQLKDAITQKSRMLILT
SPSNPTGAVYTREELEAIAETLKGTDILVASDEMYEKLVYDGATFTAAASVSEDMYNRTV
TINGLSKSVAMTGWRFGYCAAADRDLVKAMKKLQSQSTSNINSITQIASIKGLDGSADED
IEMMRRAFESRCGEAARLFNEIEGLSVIKPDGAFYLFVNHKEVEPDSMKFAKALLERAGV
AVVPGAGFGSDGYFRFSFATDIDTIRTGIERIGNFVRSYRE
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
ttggataaaatcaaggtaaaaaagggctatcatatgctttctgacagaatccagacactc
tctgaatctcttacaatggcgattaccgcactcgcacagcagctcaaacgtgagggcaag
gatattttgggcttttcggcaggagagccggacttcgatacgccgcaggtgataaaagat
gcggccatccgcgcaataaacgaaggttttacgaaatatacgcccgtagacggcatcccg
gagctcaaagaggctatcgtagagaagctgagacgcgacaacggtctcagctacgccaca
gaccaggtgattgcgagcaacggtgcgaaacagtcgctcttcaacctcttccaggccacg
ataaatcccggtgacgaagtgatcattcccgctccctactgggtgacctatccggaactg
gtgaagtactccggaggggtgcctgtagtgatagagacagatgacagcagcggattcaag
atcacaccgcagcaactgaaggatgcgattacgcaaaagagcaggatgctgattctaacc
tcaccttcaaatccgaccggtgccgtatatacaagagaggagctcgaagctatcgccgag
actcttaaaggaaccgacattctggttgccagcgacgagatgtacgaaaagctcgtatat
gacggagcgacatttaccgcggcggcatcggtcagcgaagatatgtacaaccgtactgtg
acaataaacggtctgagcaaatcggtagcgatgacaggatggcgcttcggatactgcgcg
gctgccgacagggatcttgtgaaggctatgaagaagctgcagagccagagcacttcgaac
ataaactccataacgcagatcgcctccataaaagggctcgacggaagcgctgacgaagat
atagagatgatgagaagagcattcgagtccagatgcggcgaagcggcaagactattcaac
gaaatagaggggctctcggtcataaaaccggacggggcattctacctcttcgtaaaccac
aaggaggtagagcccgactccatgaagtttgcgaaagcgcttctcgagagggccggagtg
gctgtagtaccgggtgccggattcggaagcgacggatatttccgcttcagtttcgccacc
gatatcgatacaatcagaaccggaattgaacgaatcggcaattttgtccgatcttatcgg
gagtag

DBGET integrated database retrieval system