KEGG   Hydrogenimonas sp. MAG: NNO_0929Help
Entry
NNO_0929          CDS       T05789                                 

Definition
(GenBank) aspartyl-tRNA(Asn) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
hyo  Hydrogenimonas sp. MAG
Pathway
hyo00970  Aminoacyl-tRNA biosynthesis
hyo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hyo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NNO_0929
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hyo03029]
    NNO_0929
Enzymes [BR:hyo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     NNO_0929
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     NNO_0929
Mitochondrial biogenesis [BR:hyo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    NNO_0929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: BBG65632
UniProt: A0A3G9HAS2
LinkDB All DBs
Position
904917..906347
Genome map
AA seq 476 aa AA seqDB search
MFEVIIGLEVHVQLNTKTKIFCNCATSFADRQNVHTCPVCLGLPGALPVLNVEAVKKAMM
FGNAVNATVHKKSLFNRKNYFYPDLPKGYQISQFEIPIVENGHLMIDFDDGTQKRIGITR
AHLEEDAGKNIHEGDRSLVDLNRAGTPLLEIVSEPDMRSADEAVRYLKKLHAIVRYLDIS
DANMQEGSFRCDVNVSIRPKGDEKLYTRVEIKNMNSFRFIHQAIGYEVERQIEAWEDGVY
DDEVWQETRLFDTVKGETRSMRGKEESADYRYFPEPDLLPVILTDEMMEAAKNIPEMPDE
KRRRYIEDFGLREYDATVITSEVEMARFFETMIDEGVSAKNAVTWLTVELLGRLKGGVTL
DNSPVDAKRLSSLVKRIEDGTISGKAGKEVLDYLLEHPDAGVDETIEKLGLKQVSDDSAI
LALVDEVLAANKDKVEEYRGGKEKLFGFFVGQVMKASRGSANPAKVNQLLKERLTS
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaagttatcatcggtcttgaagtgcatgtacagcttaataccaaaacgaagata
ttctgtaactgtgcaacgagtttcgccgacaggcagaacgtacacacatgcccggtatgt
cttgggcttccgggagcgctgccggttttgaatgtcgaagctgtgaagaaggcgatgatg
ttcggcaacgccgttaatgccacggttcacaagaagtcactcttcaatcgcaagaactac
ttctaccccgaccttcccaaagggtaccagataagccagttcgagataccgatcgtagag
aatggacacctgatgatcgacttcgatgacggaacgcagaaaaggatagggataaccagg
gctcacctcgaagaggatgcaggtaagaatatacatgagggtgaccgctctctggtggac
ctgaaccgtgccgggactcctcttctggagatcgtgagcgaacccgatatgagaagtgcc
gacgaggcggtacgatatctcaaaaagctccatgccatcgtcagatatctcgatataagc
gatgcgaatatgcaggaggggtcgttcaggtgcgatgtcaacgtctccatccgtccaaaa
ggtgatgaaaagctctataccagggtcgaaatcaaaaatatgaacagcttcaggtttatc
catcaggctataggatatgaggtagagcgccagatagaggcgtgggaggacggtgtatac
gatgatgaggtgtggcaggagaccaggctgttcgatactgtcaagggcgagacgcgctct
atgcgaggcaaggaggagagtgctgactacagatatttccccgagcccgatcttctgccg
gtgattttaaccgacgaaatgatggaagccgccaaaaatataccggaaatgcccgatgag
aagagacgcagatatatagaagatttcggcttgagggagtatgatgccactgttataacg
tccgaagtggagatggccagattcttcgaaacgatgatagatgagggtgtaagcgcaaaa
aatgccgtaacctggctcaccgttgaactgctcgggcgtctcaagggaggagttacgctg
gataactcgcccgtagatgcaaagaggctctcctctctggtaaaacggatagaagacggt
accatcagcggaaaagccggaaaagaggtactcgactacctgttggaacatcccgatgcc
ggcgtggatgaaacgatagagaaactcggactgaaacaggttagcgacgacagtgccata
ctggctctggtagatgaagttctggccgccaataaagacaaagtcgaggagtatagaggc
ggaaaagagaagctgttcggcttctttgtaggtcaggtcatgaaggccagcagaggctcc
gccaatcctgccaaggtcaatcaactactgaaagagcgtctaaccagttga

DBGET integrated database retrieval system