KEGG   Hydrogenimonas sp. MAG: NNO_1090Help
Entry
NNO_1090          CDS       T05789                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hyo  Hydrogenimonas sp. MAG
Pathway
hyo00473  D-Alanine metabolism
hyo00550  Peptidoglycan biosynthesis
hyo01100  Metabolic pathways
hyo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hyo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    NNO_1090
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NNO_1090
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    NNO_1090
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hyo01011]
    NNO_1090
Enzymes [BR:hyo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     NNO_1090
Peptidoglycan biosynthesis and degradation proteins [BR:hyo01011]
 Precursor biosynthesis
  Amino acid ligase
   NNO_1090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2 Mak16
Motif
Other DBs
NCBI-ProteinID: BBG65793
UniProt: A0A3G9HCR2
LinkDB All DBs
Position
complement(1057105..1058163)
Genome map
AA seq 352 aa AA seqDB search
MKFAILFGGASYEHEISIVSAIALKRVLKSPSTFIFLDADGNFFLIKPENMRSDHFSSGA
YKKDEKITPVQGGFERRGLLGSKRVDGTDTVVNLVHGAQGEDGTVAALMEFYDIPCIGPS
KEASVISYDKWFTKLYAKGLGIETVEYSLLRIDDEREIPFDYPVIVKPLRLGSSIGVSVV
RGKEDLDFALDVAFEFDDKVIIEPFMEGIKEYNVAGCRTSSGWQIGTIEAPVKKEFLDFD
QKYLDFSRTDAVAAAQIPKELEKRLIEEFKKIYGDIFEGALVRCDFFEREGEILLNEINP
IPGSMANYLFDDFASLLEELAASLPKKRNIRPNYAYINRVQSAKGPKTGSSR
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatttgcaatacttttcggaggtgccagttacgagcacgagataagcatcgtcagc
gctatagcgctcaaacgtgtgctcaaatccccgtcgacattcattttcctggatgccgac
gggaactttttcctgataaaacctgaaaatatgagatccgaccacttcagcagcggtgca
tacaaaaaggatgagaagatcactcctgtacagggtggatttgaaagaagagggctcttg
ggcagcaaaagagtcgatggaacagatacggttgtaaaccttgtacacggtgcgcagggg
gaggacggcaccgtcgctgctcttatggagttctacgacataccctgcatagggccctcg
aaagaggcttcggtcataagctacgacaagtggttcacgaagctatatgcgaagggcctc
ggtatagagactgtcgaatatagccttctccgtatagacgatgagagggagattccattc
gactacccggttatcgtaaaacctctcaggctgggaagctccataggcgtctccgtagta
agggggaaggaggatctcgatttcgccctggatgtcgctttcgaattcgatgacaaagtc
attattgagccctttatggagggtataaaagagtataacgtggccggatgcagaacctcc
tcgggctggcaaataggtaccatagaggctccggtcaaaaaggagtttctcgacttcgac
cagaagtatctagacttctcccgcacagatgccgttgcagccgcccagataccgaaagag
ctggaaaagaggcttatagaggagttcaaaaagatctatggcgacatcttcgagggggca
cttgtgaggtgcgacttcttcgagcgggaaggggagattctgctcaacgagataaatccg
attcccgggtctatggccaactacctgtttgatgatttcgcatcactgctcgaagagctt
gccgcctcgcttcccaaaaagcggaatatcaggcccaactacgcctacataaaccgtgtc
cagtcggccaaagggcccaaaacggggagcagccgttga

DBGET integrated database retrieval system