KEGG   Hydrogenimonas sp. MAG: NNO_1113Help
Entry
NNO_1113          CDS       T05789                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
hyo  Hydrogenimonas sp. MAG
Pathway
hyo00020  Citrate cycle (TCA cycle)
hyo00190  Oxidative phosphorylation
hyo00650  Butanoate metabolism
hyo01100  Metabolic pathways
hyo01110  Biosynthesis of secondary metabolites
hyo01120  Microbial metabolism in diverse environments
hyo01130  Biosynthesis of antibiotics
hyo01200  Carbon metabolism
Module
hyo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hyo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hyo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NNO_1113
   00650 Butanoate metabolism
    NNO_1113
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NNO_1113
Enzymes [BR:hyo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NNO_1113
    1.3.5.4  fumarate reductase (quinol)
     NNO_1113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Thi4 FAD_binding_3 NAD_binding_8 GIDA Pyr_redox_2 HI0933_like FAD_oxidored Pyr_redox Lycopene_cycl AlaDh_PNT_C Pyr_redox_3 Amino_oxidase
Motif
Other DBs
NCBI-ProteinID: BBG65816
UniProt: A0A3G9GWV3
LinkDB All DBs
Position
1081668..1083386
Genome map
AA seq 572 aa AA seqDB search
MSIQIHKYDVVIVGAGLAGLAAARELQRAGKSVAVLTKLHPLRSHSGAAQGGVNAALSED
DDIELHMFDTVKGSDYLADQDAVELMCSKAPETIRWIANSGAAFSRKDDGTIAQRPFGGQ
SKPRACYARDRTGLTLLQTIYEQADRENVTFFDEWYVADIIYEDGVVKGVVAYNIRNLEP
AIFNAKATMFATGGYARAFKISSNAHANTGDGLSIVARHGLPLEDMEFVQFHPTGLAGSG
ILISEAARGEGGRLYNSLGERFMEKYAPEKMELAPRDVVSRAITQEILEGRGVGPHKDAV
AIDLTHLGEEIIMERLPELRDLAITFLGQDMLKEPIHIAATAHYSMGGIPCDIDGHVKKS
PKEIVRGFYAAGECACVSVHGANRLGANSLLEALFFGRHVGTHIVEDLEKGILECHAAKE
EDAERMLAEIKFCMNNNGTESVPKLRAELQESMMANAGVFRTEETLLKQRAVIAELRERY
RNIRIDDKSKIFNTDLQEAIELGHMLDYSSFIVEGAIARKESRGAHYRDDYPKRDDENFL
KHTFATMNEDGSINIEYGDVVLGKFEPQERKY
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgagtatacagatacacaaatacgatgttgtgattgtcggtgccgggcttgccgggctg
gcagccgcaagggagcttcaaagagcgggcaaaagcgttgccgtcctgactaaactgcat
ccgctcagaagccactcgggagcggcacagggcggtgtcaacgccgcactgagtgaagat
gacgatatcgaactccatatgttcgatacggtcaaagggagcgactacctggctgaccag
gatgccgtagagctgatgtgttccaaagcgcctgaaacgatcagatggatcgccaacagc
ggtgccgctttcagcagaaaagatgacggtacaattgcgcagcgcccgttcggcggacag
tcgaaaccgagagcctgttatgcaagagaccggaccggtcttacgctgcttcagacaata
tatgagcaggccgaccgcgaaaatgtaacctttttcgacgagtggtacgttgccgacatc
atatatgaagatggcgtagtaaagggtgtagttgcctacaatatccgcaatctcgaacct
gcgatattcaatgcgaaagcgacgatgttcgcgacaggcggatatgcaagggctttcaaa
atcagctcaaacgcgcatgcgaacaccggcgacggcctatccatcgtagcgcgccacgga
cttcctcttgaagatatggagttcgtacagttccacccgaccggtctggcgggaagcggt
attctcatctccgaagccgccaggggagaaggcggacggctctacaacagcctcggcgag
agatttatggagaagtacgcccccgaaaagatggagctggcaccccgcgacgtcgtaagc
cgcgccatcacccaggagattctggaagggcgcggtgtaggcccgcacaaagatgcggtg
gcgatagatctgactcacctcggagaagagatcatcatggagcgccttcccgagctcagg
gatcttgcaataacgttcctcgggcaggatatgctgaaagagcctatccatatcgcagca
accgcgcactactccatgggcggtattccgtgcgacatagacgggcacgtcaaaaagagc
ccgaaagagatcgtacgcggcttctacgccgccggtgagtgcgcatgtgtaagcgtgcac
ggcgccaacaggctcggcgcgaactctctgctcgaagccctcttcttcggacgccacgtc
gggacacacatcgtggaagatctcgaaaaaggtattctcgagtgtcatgccgcaaaagag
gaagatgccgagaggatgcttgccgagatcaagttctgcatgaacaacaacggcaccgag
tccgttccgaagcttcgggcagaactgcaggagagtatgatggccaacgccggagttttc
agaacggaagagacgcttctgaaacagcgcgcagttatcgccgaactcagggagcgctac
agaaacatccgcatagacgacaagagcaaaatattcaataccgatcttcaagaggcgatc
gaattgggccacatgctcgactactcttcgttcatcgtggagggtgcgatcgcgagaaaa
gagagccgcggcgctcactaccgcgacgactatcccaaacgggatgacgaaaatttcctg
aagcatacgtttgcgacgatgaatgaagacggatcgataaacatagagtacggcgatgtg
gtactcggcaaattcgagccgcaagagcgaaaatattaa

DBGET integrated database retrieval system