KEGG   Hydrogenimonas sp. MAG: NNO_1114Help
Entry
NNO_1114          CDS       T05789                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
hyo  Hydrogenimonas sp. MAG
Pathway
hyo00020  Citrate cycle (TCA cycle)
hyo00190  Oxidative phosphorylation
hyo00650  Butanoate metabolism
hyo01100  Metabolic pathways
hyo01110  Biosynthesis of secondary metabolites
hyo01120  Microbial metabolism in diverse environments
hyo01130  Biosynthesis of antibiotics
hyo01200  Carbon metabolism
Module
hyo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hyo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hyo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NNO_1114
   00650 Butanoate metabolism
    NNO_1114
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NNO_1114
Enzymes [BR:hyo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NNO_1114
    1.3.5.4  fumarate reductase (quinol)
     NNO_1114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_9 Fer4_17 Fer4_18 Fer4_7 Fer2 Fer4_16 Fer4 Fer4_21 Fer4_2 Fer4_4 Fer4_6 Fer4_15 Fer4_20 Fer4_13
Motif
Other DBs
NCBI-ProteinID: BBG65817
UniProt: A0A3G9HJ91
LinkDB All DBs
Position
1083396..1084379
Genome map
AA seq 327 aa AA seqDB search
MSSERITKKLTFKTFRFNAETDFLPYFKTYEMEVGKDELVLDILNRIKWEFDGSFSYRRS
CRHGICGSCSIKVNGKPVLSCKQNVWELVDIFDTDTLLLEPQSRKRVVKDMIIDKKDFWE
KHAKLKPYLVAEIDEHPKEEIKVSPHEAEQLLEADYCIQCGNCYYACPVVEVNEEYFGPA
QFAKAYRFNADVRDNAKTERLEKVREMGPGVWDCVKCFECAEACPKDVDPIGKITKLHNQ
LFEEGMAQDNVATRHAVGFKHSIVKHGLLDEGELVRYSEGTLGVMKHLPEAIAMFKKGKI
VMPWNMPKSEKLDEIKTLVKSSSKVKF
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtgaacgaataacgaaaaaattgacttttaaaaccttccgtttcaacgcggaa
accgattttctgccctactttaaaacatatgagatggaagtgggcaaagatgaactggtt
ctggatattctgaaccgtatcaagtgggagttcgacggaagcttcagctaccgaagaagc
tgtcgtcacggtatatgcggcagctgttcgatcaaggtgaacggaaagccggttctctcg
tgcaaacagaatgtctgggagcttgtcgatatattcgataccgacacccttctgctggag
cctcagagcagaaagcgcgtcgtgaaagatatgataatagacaaaaaagatttctgggaa
aagcatgcgaaactgaagccctatctcgtagccgagatagatgagcatccgaaagaggag
atcaaagtctctccgcatgaagcggagcagcttctagaagccgactactgcatccagtgc
ggcaactgctactacgcatgtccggttgtcgaggtcaatgaagagtacttcggtcccgcg
cagtttgcaaaagcgtaccgtttcaacgccgatgtacgcgacaatgcgaaaaccgagcgc
ctggaaaaagtgcgtgaaatgggccccggtgtatgggactgcgtcaagtgcttcgagtgt
gccgaagcctgcccgaaagatgtcgatcctataggcaaaatcacgaagctccacaatcag
ctcttcgaagagggaatggcacaggacaatgttgcgacaagacacgccgtaggcttcaaa
cactccatcgtcaagcacgggctcctggacgaaggggagctggtacgctactcagaagga
actctgggtgtaatgaaacacctgcccgaagcaatagcgatgttcaaaaaagggaagatc
gttatgccttggaatatgccgaaatctgaaaaactcgacgagatcaaaacactggtcaag
agctcgtcgaaagttaaattttaa

DBGET integrated database retrieval system