KEGG   Hydrogenimonas sp. MAG: NNO_1142Help
Entry
NNO_1142          CDS       T05789                                 

Definition
(GenBank) secretion protein HlyD family protein
  KO
K03543  membrane fusion protein, multidrug efflux system
Organism
hyo  Hydrogenimonas sp. MAG
Brite
KEGG Orthology (KO) [BR:hyo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hyo02000]
    NNO_1142
Transporters [BR:hyo02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   NNO_1142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_3 HlyD_D23 Biotin_lipoyl_2 HlyD HlyD_2 FliJ Biotin_lipoyl PTS_EIIA_1 SHE3 DUF3584 BLOC1_2 DUF1848 DUF4200 GAS DUF3618
Motif
Other DBs
NCBI-ProteinID: BBG65845
UniProt: A0A3G9GYA1
LinkDB All DBs
Position
1106507..1107622
Genome map
AA seq 371 aa AA seqDB search
MGRRVGTLIILVLVVLFAYGGYRYFSFRSANAVSEAAFIKSDRLANLTFKVDGKVTEMLK
KENEPVKEGELLAVIDPTDLKVAKEELLHIIESLVKSTDAMELKKRRLKESLALETSIAG
SDNESVTMKLKSLGFRIKAAETKLEKLDKDTLRYEKMLRKRLIASSDFESVRTERDSLSD
EIEGMRREYDALKAAEKASRERYRLAMVQQRTIEELQKGIEAKREELKSRREALSDIENK
IGYTRLYAPFDGVIAKRYFEAPLVVEKGTPVYALIDPSALYCEVLLSEKKMRGVKPGNPV
TITVDALEGREISGKVESIAPVSASTFSLVPRDIASGEFTKLDQRFKIRISIEETEGLRS
GMSASVAIERR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgggcagaagagtcggaacgcttataattctagtacttgttgttctgtttgcctacggc
ggatacaggtatttctctttccgctccgcaaatgccgtcagcgaagcggctttcataaag
agtgacaggcttgccaacctcacattcaaagttgacggcaaggtgactgaaatgttgaaa
aaagagaatgagccggtgaaagagggtgagctgctcgcggtgatcgaccctacggacctg
aaggtcgccaaggaggagcttcttcatatcatagagagccttgtaaagtcgacggatgcc
atggagttgaaaaagagacggctcaaggagtcactggcccttgaaacatctatagccgga
agtgacaacgaatcggtaacgatgaagctcaaatctctcggcttcaggataaaggccgca
gagacgaagctggaaaagctggacaaagatacgctcagatacgaaaagatgctccgaaag
aggctcatagcctcatccgatttcgagtcggtccgtaccgaaagagactccctttctgat
gagatagaggggatgagaagagagtacgacgctctcaaggcggcggaaaaggcatcgaga
gagagatacaggcttgccatggtacagcagcggacgatagaggagctgcaaaaaggcata
gaagccaagagagaggagctgaagtcgcgcagggaggcactatccgacatagagaacaag
ataggctacaccaggctatatgctccgtttgacggtgttatagcgaagagatatttcgaa
gcgccgcttgtagttgaaaaagggacacccgtctatgctctgatagacccttcggctcta
tactgcgaagtgcttctctccgagaagaagatgaggggggtaaagccgggcaacccggtt
actattacagtagacgcgttggaggggagagagataagcggtaaagtagagtctattgca
ccggtatccgcctcaaccttctctctggtaccgagagatatagccagcggagagttcacc
aagctcgaccagcgtttcaagatacgcatctcgatagaggagaccgaaggcctcaggtcg
ggcatgagcgcttccgtagcgatcgaaaggagatag

DBGET integrated database retrieval system