KEGG   Hymenobacter sp. PAMC 26554: A0257_10015Help
Entry
A0257_10015       CDS       T04376                                 

Definition
(GenBank) beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
hyp  Hymenobacter sp. PAMC 26554
Pathway
hyp00052  Galactose metabolism
hyp00511  Other glycan degradation
hyp00600  Sphingolipid metabolism
hyp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hyp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    A0257_10015
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    A0257_10015
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    A0257_10015
Enzymes [BR:hyp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     A0257_10015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C DUF4982 Glyco_hydro_2_N Glyco_hydro_2 Invasin_D3 Big_1
Motif
Other DBs
NCBI-ProteinID: AMR27398
UniProt: A0A142HEU0
LinkDB All DBs
Position
2375448..2377892
Genome map
AA seq 814 aa AA seqDB search
MSFAKPLAAALLLAASLPAAAQSRQETLLKTNWKFTRGEQPNGTRPELNDAQWQTVRIPH
DWAITGPFSGQNDAQVVKIEQNGEQTATLKSGRTGGLPFVGVGWYRRALAVPKLGKNGQA
VLLFDGAMSNARVYINGKEAMFWPYGYNSFSVDITPYLRASGPNTLAVRLENQPEASRWY
PGAGLYRNVHLITTQGAHVPVWGTYITTPTITAEAATVRLRTKVEAPVGTTGLTLRTELR
DASGRVVATATTPVTGAEVEQNFEVKAPRLWSPETPVLYRAESQLLAGTTVQDTYKTPFG
IRSFKFEKGTGFSLNGQPRKFKGVCNHHDLGPLGTAVNVAALRHQLLLLKDLGCDAIRTT
HNMPAPELMTLCDELGFMVMVESFDEWKVPKVKNGYSQYFDQWVEKDLTNMVHRDRNHPS
AIMWSIGNEVPDQSTPEGPAIARRLQDIVHREDSTRPVTAGMDRFDDDFKYGFAAVLDVP
GFNYKPARYPEAIAKLPQGFLLGTETASTVSSRGVYKFPVVAAKDKQYPDNQCSSYDLEA
CRWSQIPDVEFAAQDDYPYVAGEFVWTGFDYLGEPTPYDEKWPSHTSYFGLLDLASQPKD
RYYLYRARWNPTQPTLHLLPHWTWPGREGQVTPVFCYTNAPSAELFVNGKSQGRQAKATT
ADPQTRYRLEWPDVVYQPGAIKVVAYDAQGKEVGTEEVRTAGAPDHIRLVADHTRLAADG
EDLAYLTARVEDARGNLCPEATQQLHFAVSGAGRFRAIGNGDATCLEPFQLPQMHAFRGQ
LVAIVQAGETAGTVQVKATAAGLKEGILQLTTAR
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttgctaaacccctggccgccgcgctgctgctggccgccagcctgcccgccgcc
gcccaaagccgccaggaaaccctgctcaagaccaactggaaatttacccgaggcgagcag
cccaacggtaccaggcccgagctgaacgacgcccagtggcagaccgtgcgcattccgcac
gactgggccatcacggggccgtttagtggccaaaacgatgctcaggtagtgaaaatcgag
caaaacggcgagcagacggctaccctcaaatcgggccgcacgggtgggctgcccttcgtg
ggcgtgggctggtaccggcgcgcgctggcggtgcccaagctaggaaaaaatggccaagcc
gtgctgctgtttgatggcgcgatgagcaacgcgcgggtttatatcaacggcaaggaagcc
atgttctggccttacggctacaactcgttctcggtcgatatcacgccctacctgcgcgcc
agcggccccaacacgctggccgtgcgcctcgaaaaccaacccgaagcctcgcgctggtac
ccaggagcgggcctgtatcgcaacgtgcacttaatcaccacgcaaggcgcgcacgtgccg
gtttggggcacctatattactacccccaccatcacggccgaagccgccacggtgcggctg
cgcaccaaagtagaagcgcccgtcggcaccaccggcctgacgctgcgaaccgagctgcgc
gacgccagcggccgcgtggtggccaccgccactacccccgtcacgggggccgaagtggag
cagaatttcgaggtgaaagcgcccaggctgtggtcgcccgaaacgccggtgctctaccgg
gccgagtcgcagctgctggccggcacgacggtgcaggacacctataaaacgccgttcggc
attcgctctttcaagtttgagaagggcaccggtttttcgctcaatgggcagccgcgcaag
tttaagggcgtgtgcaaccaccacgacctggggccgctgggcacggccgtgaacgtggcc
gcgctacgccaccaactgctgctgctcaaggacctgggctgcgatgccattcggactacg
cacaacatgcccgcgcccgaactgatgacgctctgcgacgagttgggttttatggtgatg
gtggagtcatttgacgagtggaaggtgcccaaggtgaagaacggctacagccagtatttt
gaccagtgggtggaaaaggacctcaccaacatggtgcaccgcgaccgcaaccacccgtcg
gccattatgtggagcatcggcaacgaggtgcccgaccagagcacgcccgaaggcccggcc
attgcccggcgactgcaagacatcgtgcaccgcgaagactctacccgccccgtaacggcc
ggcatggaccgcttcgacgatgattttaagtatggcttcgcggcggtgctcgacgtgccg
ggcttcaactacaagcccgcgcgctatcccgaggccattgccaagctgccgcagggcttt
ttgctgggcaccgaaacggcctccactgtcagctcgcggggcgtgtataagtttccggtg
gtggcggccaaggacaagcaatatcctgataaccagtgctcttcctacgacctggaggct
tgccgctggtcgcagattcccgacgtcgagttcgcggcccaggacgactacccctacgtg
gccggcgagtttgtgtggaccggcttcgactacctcggcgagccgacgccctatgatgag
aagtggccttcgcacacctcctatttcggcctgctggacctggccagccagcccaaggac
cgctactacctctaccgcgcccgctggaaccccacgcagcccacgctgcacctgctgccg
cactggacctggcccggccgcgagggccaggtcacgcccgtgttctgctacaccaacgcg
ccttcggctgaactgttcgtgaacggcaaaagccagggccgccaggccaaagccaccacc
gctgacccccaaacccgctaccgcctggagtggcccgatgtggtgtaccaacccggcgct
atcaaggtggtggcctatgacgcgcagggcaaggaagtcggcaccgaggaagtgcgcacg
gccggcgcgcccgaccacattcgcctcgtggccgaccacacccggctggccgccgatggc
gaagacctcgcctacctcacggcccgcgtggaagacgcgcggggcaacctctgccccgag
gctacccagcagctgcacttcgcggtgagcggcgcgggccggttccgcgccatcggcaac
ggcgacgccacgtgcctggagccgttccagctgccccagatgcacgcttttcgggggcag
ctcgtggccatcgtgcaggccggcgaaacggcgggcactgtgcaggtgaaggccacggcc
gccggcctgaaggagggaattttgcagctgactacggccaggtaa

DBGET integrated database retrieval system