KEGG   Hymenobacter sp. PAMC 26554: A0257_12185Help
Entry
A0257_12185       CDS       T04376                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
hyp  Hymenobacter sp. PAMC 26554
Pathway
hyp00380  Tryptophan metabolism
hyp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hyp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    A0257_12185
Enzymes [BR:hyp01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     A0257_12185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AMR27778
UniProt: A0A142HFX0
LinkDB All DBs
Position
2885338..2886618
Genome map
AA seq 426 aa AA seqDB search
MTYDASPAFATAQDAADPLKAFRHEFHFPPGPDGQPVAYFCGNSLGLLPRAARAAVEAEF
QAWETKAVEGHFHGESPWMYYQDNLAESAARVVGAQPLEVVIMNTLTVNLHLLLISFYQP
TPTRYKVLMEGGAFPSDQYALESQARLHGFDPAEAIVEMQPRPGEHTLRTEDIEAKIAEL
GSSLATVIFGGINYYTGQVFDMAAITRAGHAVGAKVGFDLAHAAGNVVLHLHDWDVDFAC
WCTYKYLNSGPGGTSGVFIHERFAHQPDLLRLAGWWGNDPAERFQMQKGFRPAAGAAGWQ
LSCGQVLPMAVHRVNLELFDRAGGVGALRAKSEKLTGYLEFLINQLGLPTSRLEIITPPN
PAERGCQLSLLVHERGRALFDYLAARGVVADWREPNVIRLAPVPLYNSFEDVYRVGAALL
QFYSAQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgacctacgacgcttcgcccgcttttgccaccgcccaggatgcggccgacccgctgaaa
gcgttccgccacgagtttcattttccgccgggaccggatgggcagccggtagcgtatttc
tgcggcaactcgctggggctgctgccccgcgccgcccgcgccgccgtggaggccgagttt
caggcctgggaaaccaaggcggtggagggccactttcacggcgagtcgccctggatgtat
taccaggataacctggctgagtcggcggcccgcgtggtgggcgcccagccgctggaagtg
gtgataatgaacacgctaacggtgaacctgcacctgttgctcatctccttttaccagcct
acccccacccgctacaaggtgctgatggaaggcggcgcgttcccttcggaccaatacgcg
ctcgaaagccaggcccgcctgcacggcttcgacccggccgaagccattgtggagatgcag
ccccggcccggcgagcacaccctgcgcacggaggacatcgaggccaaaatcgcggagctg
ggcagctcgctggccacggtcatttttgggggtattaactactacacggggcaggtgttt
gacatggcggccatcacgcgggcggggcacgcggtgggcgcgaaagtgggtttcgacctg
gcccatgcggccggcaacgtggtgctgcacctgcacgactgggacgtggactttgcctgc
tggtgcacctataaatacctcaattcggggccgggcggcacgtcgggcgtgtttattcac
gagcgctttgcgcaccagcccgatttgctgcggctggccggctggtggggcaatgacccc
gccgagcgctttcagatgcaaaaaggctttcggccggcggcgggcgcggcgggctggcag
ctctcgtgcgggcaggtgctgccgatggccgtgcaccgcgtcaaccttgagctcttcgac
cgggcggggggggtaggcgccctgcgcgccaagagcgaaaagctgaccggctacctcgaa
tttctcatcaaccagctcggcctgcccaccagccggctcgaaattattaccccccccaac
ccggccgagcgcggctgccagctttcgctgctggtgcacgagcgcgggcgggcgctgttc
gactacctggccgcgcggggggtagtggccgactggcgcgagccgaatgtcatccggctg
gcacccgtgccgctgtataattcgtttgaggacgtatatcgggtgggcgcggcgcttttg
caattttacagcgcgcagtga

DBGET integrated database retrieval system