KEGG   Hymenobacter sp. PAMC 26554: A0257_15425Help
Entry
A0257_15425       CDS       T04376                                 

Definition
(GenBank) efflux transporter periplasmic adaptor subunit
  KO
K03543  membrane fusion protein, multidrug efflux system
Organism
hyp  Hymenobacter sp. PAMC 26554
Brite
KEGG Orthology (KO) [BR:hyp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hyp02000]
    A0257_15425
Transporters [BR:hyp02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   A0257_15425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_D23 Biotin_lipoyl_2 HlyD_3 HlyD Biotin_lipoyl ATP-grasp_5 PTS_EIIA_1 HlyD_2 YqfD
Motif
Other DBs
NCBI-ProteinID: AMR28343
UniProt: A0A142HHI5
LinkDB All DBs
Position
3607509..3608594
Genome map
AA seq 361 aa AA seqDB search
MATQTELQDVPPTAVAEPMEPEKKRNPLVLIIVALVLLVGGYFGWTRYQFSKVHESTDDA
SVEGDVYPIIPRVSGPVLKVFVADNQTVKKGDTLVTIDKSDYQQRVNAAHAALLAAQAQV
TAARAQVGTAQANVRTAQTTIGVSEANRVKLRQDLARSVKLRKDDIIPQSDYDAVQANLS
ATNAQRSTANDMVTVAREQVTAAQQQVVVAQAVVKQRQADLDNTNLQLSYTTMLAPANGY
VSKKNVQPGQVVSPGQQLMGLVSSGKTWVIANFKETQLENMKVGQTAKLEIDSYPNEDFE
GHIESLSAATGARFALLPPDNSTGNFVKVTQRIPVKIVLNKEDPEHPLRAGMSVNAIVSV
K
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggctactcaaaccgaactccaagacgtgcctccgaccgccgtggccgagccgatggaa
cccgaaaaaaagcgtaatccgctcgtgcttatcatcgtggcgctcgtgctgctggttggc
ggctacttcggctggacgcgctaccagttttccaaagtccacgaaagcaccgacgacgct
tcggtcgaaggcgacgtgtaccccatcattccccgcgtgtcgggcccggtgctgaaggta
tttgttgcggacaaccagaccgtgaagaagggtgacacgcttgttaccatcgacaagtcg
gactaccagcagcgcgtcaacgccgcccacgccgccctgctggctgcccaggcccaggta
acggccgcccgcgctcaggtgggcacggcccaggccaatgtgcgcaccgcccaaaccacc
atcggcgtgagcgaggccaaccgcgtcaagctccggcaggacttggcccgtagcgtgaag
ctgcgcaaggacgacatcattccgcagagcgactacgatgccgtgcaggctaacctgagc
gccaccaacgcccagcgtagtaccgccaacgacatggtaacggtggcccgcgagcaggta
accgccgctcagcagcaggtagtagtggcccaggccgtggtaaaacagcgccaggctgac
ctcgacaacaccaatctccagctcagctacacgaccatgctggccccggccaatggctac
gtgagcaagaaaaacgtgcagcctggccaagtagtatcgcccggccagcagctgatgggc
ctggtgagcagcggcaaaacctgggttatcgccaacttcaaggaaacccagctcgaaaac
atgaaagtgggccaaacggccaagctggaaatagattcctaccccaacgaagattttgag
ggccacatcgagtcgctgtcggccgcaaccggcgcgcgcttcgcgctactaccccccgat
aactcgaccggcaacttcgtgaaagtgacccaacgcatacccgtcaaaatcgtgcttaat
aaggaagaccccgagcaccccctgcgcgctggcatgagcgtcaatgccatcgtttcggtg
aagtag

DBGET integrated database retrieval system