KEGG   Hymenobacter sp. PAMC 26554: A0257_20930Help
Entry
A0257_20930       CDS       T04376                                 

Definition
(GenBank) galactose mutarotase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
hyp  Hymenobacter sp. PAMC 26554
Pathway
hyp00010  Glycolysis / Gluconeogenesis
hyp00052  Galactose metabolism
hyp01100  Metabolic pathways
hyp01110  Biosynthesis of secondary metabolites
hyp01120  Microbial metabolism in diverse environments
hyp01130  Biosynthesis of antibiotics
Module
hyp_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:hyp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A0257_20930
   00052 Galactose metabolism
    A0257_20930
Enzymes [BR:hyp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     A0257_20930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AMR29885
UniProt: A0A142HLX7
LinkDB All DBs
Position
4935372..4936478
Genome map
AA seq 368 aa AA seqDB search
MTTDSTRTDAVTLPVATPFGKTKEGIAVQLFTLTNAQGMKATITNFGGTLTSMLVPDKTG
KLGDVVLGFDDLAGYTSDLFRKENPYFGTLIGRYGNRIAKGRFMLDGTAYHLPINNAPNS
LHGGTSGFNQRVWTATPGTSAEGETLTLSYLSKDGEEGYPGNLRVSVVYTLTNSGALRLA
YTATTDKPTVLNLTNHSYFNLNYGQDKDILGHELTLNAERFTPVDNTLIPTGKLQAVAGT
PMDFRQPHAIGARIGQVPGAAPGGYDHNWVLADSLRNTPALAATVYEPITGRTMQVYTDQ
PGVQFYSGNFLKGNLKGKGGVAYPQHYGFCLETQHFPDSPNEPAFPSTVLRPGATFHSVT
EYRFGVRK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgactactgattcgacccgcactgacgccgtcacgctgcccgtggctacgccctttggc
aaaaccaaagaaggaattgctgttcaactttttacgctgacaaatgctcagggtatgaaa
gccacgattaccaactttggtggcacgctgaccagcatgctggtgccggataaaaccggc
aagctgggcgatgtggtgcttggcttcgacgacctggcaggctacaccagcgacctgttt
agaaaggaaaatccctatttcgggaccctgattgggcgctacggcaatcgcatcgcgaag
ggcaggttcatgctggatggcacggcttatcacctgcccattaacaacgcgcccaactcg
ctacacggcggcaccagcggctttaaccaacgcgtgtggacggctacgcccggcacctca
gccgagggtgaaacgctgacgctcagctatctgagcaaggatggggaggagggctacccc
ggcaacctgcgcgtgagcgtagtttatacgctcaccaactcgggcgcgttgcgcctcgcc
tacacggccaccacggataagcccaccgtgctcaacctcaccaaccatagctacttcaac
ctgaactatgggcaggacaaggatattctgggccacgagctaacgctgaacgccgagcgc
tttacgccggtagataacacgctgattccgactggtaagctgcaagccgtggctggcacg
ccaatggattttcggcagccacacgccattggcgcacgcattgggcaggtgccgggcgcg
gctcccggcggctacgaccacaattgggtgctggccgacagcctgcgcaacacgcccgcg
ctggctgccaccgtgtatgagcccatcaccggccgcacgatgcaggtgtacaccgaccaa
ccgggcgtgcagttctattcgggtaactttctgaaaggcaacctgaaaggcaagggcggc
gtggcctacccccagcactacggcttctgcctcgaaacccagcacttccctgactcgccc
aatgagccggcttttccgagtaccgtgctgagaccaggcgcgacgtttcactcagtgacg
gaataccggtttggggttcgtaagtag

DBGET integrated database retrieval system