KEGG   Hydrogenophaga sp. RAC07: BSY239_1099Help
Entry
BSY239_1099       CDS       T04455                                 

Definition
(GenBank) hypothetical protein
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
hyr  Hydrogenophaga sp. RAC07
Pathway
hyr00030  Pentose phosphate pathway
hyr01100  Metabolic pathways
hyr01120  Microbial metabolism in diverse environments
hyr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hyr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BSY239_1099
Enzymes [BR:hyr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     BSY239_1099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N tRNA-synt_1_2
Motif
Other DBs
NCBI-ProteinID: AOF85697
UniProt: A0A1B3LY06
LinkDB All DBs
Position
1167542..1169389
Genome map
AA seq 615 aa AA seqDB search
MSWAGKILRVNLTAGTVKSEPLNTEWARSYIGSRGLGSKYLVSEVDPKVDPLSPENKIIW
ATGPLTGTMASTGGRYTVITKGPLTGAIACSNSGGYWGAELKMAGWDMIIFEGKSPKPVY
LYINDDEAELRDAGHLWGQSVWKTEEVLKSSLQDPLVRVSSIGKAGENGVLYAAVVNDLH
RAAGRSGVGAVMGSKNLKAIAVRGTKGVGNIRDPKAFMKTTFEKKKILAENAVTGQGLPA
YGTQVLMNVINEMGALPTRNHRDVQFEGAKDISAEAMVTPRESDGKKHLVTNQACFGCTI
ACGRISKMDENHFTVKNKPQYWGANGGLEYEAAWALGAANGVNDLEALQYANLLCNEEGF
DPISFGATVGAVMELYEMGVLTAEQLGIDAKFGSAQALAHFAEITARGEGFGKEIGMGSK
RLTEKYGHPDLSMSVKGQEFPAYDGRAIQGIGLAYATSNRGACHLRGYTIASEVLGIPVK
TDPVESEGKPELVKAFQDATAAFDSSGLCVFTTFAWGVADLAPQLQAACNEEFTTEELEK
IGERIWNMEREFNNAAGFTSKDDSLPKRLLTEAAKTGASKGMVSKLPEMLPKYYAARGWD
TEGRPTAETRARLSL
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgtcatgggctggaaaaatcctccgcgtcaacctgaccgcgggcaccgttaaatccgaa
ccgctgaacaccgagtgggcacgttcctacatcggctcgcgtgggctgggcagcaagtac
ctggtgagcgaggttgaccccaaggtcgacccgctgtcgcccgagaacaagatcatctgg
gccaccggccccttgaccggcaccatggcctccaccggcggccgttacaccgtgatcacc
aagggcccgctgaccggggccattgcgtgttcgaactcgggcggctactggggcgccgag
ctcaagatggccggctgggacatgatcatcttcgagggcaagtctccgaagccggtctat
ctctacatcaacgacgacgaggccgagctgcgcgacgccggccacctctggggtcagagc
gtgtggaagaccgaagaggttctcaagtccagcctgcaggacccgctggtgcgcgtgtcg
agcatcggcaaggccggtgaaaacggcgtgctgtacgcggcggtggtgaacgacctgcac
cgagcggccggccgttccggcgtgggcgccgtcatgggcagcaagaacctgaaggccatt
gccgtgcgcggcaccaagggcgtgggcaacatccgcgaccccaaggccttcatgaagacc
accttcgagaagaagaagatcctggccgagaacgcggtgacgggtcagggcctgccggcc
tacggcacgcaggtgctcatgaacgtgatcaacgagatgggcgcactgcccacgcgcaat
caccgcgacgtgcagttcgaaggcgcgaaggacatctcggccgaagccatggtcaccccg
cgcgagagcgacggcaagaagcacctggtgaccaaccaggcctgcttcggttgcaccatt
gcgtgcggtcgcatcagcaagatggacgagaaccacttcaccgtgaagaacaagccgcag
tactggggcgccaacggcggcctggagtacgaagcggcctgggcgctgggtgctgccaac
ggcgtgaacgatctggaagcactgcaatacgccaacctgttgtgcaacgaagaagggttt
gatcccatcagcttcggtgccaccgtgggcgcggtgatggagctctacgaaatgggcgtg
ctcaccgccgagcagctcggcatcgacgccaagttcggttcggcgcaagccttggcccac
tttgccgagatcaccgcgcgcggcgaaggcttcggcaaggagatcggcatgggctccaag
cgcctgaccgaaaaatacggccaccccgacctgtccatgagcgtgaagggccaggagttc
ccggcctacgacggtcgcgcgatccagggcatcggcctggcgtacgccacgagcaaccgc
ggcgcctgccacctgcgcggctacaccatcgcgtctgaagtgctgggcattccggtcaag
accgatccggtcgagagcgaaggcaagccggagctggtgaaggcgttccaggacgccacc
gccgcgttcgactcctcgggcctgtgcgtgttcaccaccttcgcctggggcgtggccgat
ctggcaccgcagctgcaagccgcgtgcaacgaagagttcaccaccgaagagctggagaag
atcggtgagcgcatctggaacatggagcgcgaattcaacaacgccgcgggcttcacgtcc
aaagacgacagcctgcccaagcgcctgctgaccgaagcggccaagaccggtgcttccaaa
ggcatggtcagcaagctgcccgagatgctgcccaagtactacgccgcacgcggctgggac
accgaaggccgccccaccgccgagacccgcgcgcgcttgagcctgtaa

DBGET integrated database retrieval system